LXL04_027790 | RubberDandelionOmics

Gene overview

LXL04_027790

Reference: OH-1004 Chr: Chr06 Coordinates: 24042086-24043519 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

492 bp · LXL04_027790|LXL04_027790|OH1004|cDNA

ATGGAAGATCAGCGAATCTTCCTGGTGTATGAATTTATGCCTAACGGAAACTTTCAGGATCTCTTGGATAGGGGAAGGGTAAAACAGCTTTCGTTAATTACAAAGGTGAAAATATCAGTAGGAATCGCTCCAGGGATTGTTTACTTGCACAATACAGAATACCGTCATGATGTTTGTAAGTGCCAACTTCACAGAGATAAGATATTGCTGGATGAGGATTTTACGGCAAAGCTCTCAGGTTATGACATTACTCTATTAGA...

CDS

Download CDS FASTA

492 bp · LXL04_027790|LXL04_027790|OH1004|CDS

ATGGAAGATCAGCGAATCTTCCTGGTGTATGAATTTATGCCTAACGGAAACTTTCAGGATCTCTTGGATAGGGGAAGGGTAAAACAGCTTTCGTTAATTACAAAGGTGAAAATATCAGTAGGAATCGCTCCAGGGATTGTTTACTTGCACAATACAGAATACCGTCATGATGTTTGTAAGTGCCAACTTCACAGAGATAAGATATTGCTGGATGAGGATTTTACGGCAAAGCTCTCAGGTTATGACATTACTCTATTAGA...

Protein

Download Protein FASTA

163 aa · LXL04_027790|LXL04_027790|OH1004|PROTEIN

MEDQRIFLVYEFMPNGNFQDLLDRGRVKQLSLITKVKISVGIAPGIVYLHNTEYRHDVCKCQLHRDKILLDEDFTAKLSGYDITLLERDLGQLPTDLSGFTMLFAEYPWLVLQIKSCFEICIEVDSKLKMLRILEEYEEYIPACQKLEFTKPPIKYFLSATYS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027790`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027790

Location Chr06:24042086-24043519 (-)

Description Similar to SD22: G-type lectin S-receptor-like serine/threonine-protein kinase SD2-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00340`	Serine/threonine-protein kinase.	No verified direct reference in this release
`At5g10530`	Promotes hydrogen peroxide H(2)O(2) production and cell death.	No verified direct reference in this release
`At5g49660`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	XYLEM INTERMIXED WITH PHLOEM1, a leucine-rich repeat receptor-like kinase required for stem growth and vascular development in Arabidopsis thaliana.2012 · DOI: 10.1007/s00425-011-1489-6 CEP5 and XIP1/CEPR1 regulate lateral root initiation in Arabidopsis.2016 · DOI: 10.1093/jxb/erw231
`At1g78530`	Receptor-like serine/threonine-protein kinase At1g78530.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0511000`	LysM domain receptor-like kinase 10.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027790 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002229 defense response to oomycetes Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010200 response to chitin Biological Process

GO:0010311 lateral root formation Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0045087 innate immune response Biological Process

GO:0048437 floral organ development Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0048831 regulation of shoot system development Biological Process

KEGG gene cross-reference

ath:AT1G78530

ath:AT4G00340

ath:AT5G10530

ath:AT5G49660

dosa:Os09g0511000

osa:9270778

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.439

Rank 1 · LXL04_027790 · OH-1004

Nucleus0.273

Rank 2 · LXL04_027790 · OH-1004

Cell membrane0.234

Rank 3 · LXL04_027790 · OH-1004

Endoplasmic reticulum0.111

Rank 4 · LXL04_027790 · OH-1004

Mitochondrion0.097

Rank 5 · LXL04_027790 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714.24PK_Tyr_Ser-Thr2-81 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027790	`PF07714.24`	PK_Tyr_Ser-Thr	2	81	6.6e-07	29.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39203`	Arabidopsis thaliana	G-type lectin S-receptor-like serine/threonine-protein kinase SD2-2	36.364%	Swiss-Prot	moderate database homology
`Q9LXA5`	Arabidopsis thaliana	L-type lectin-domain containing receptor kinase IX.1	33.929%	Swiss-Prot	moderate database homology
`Q9FGL5`	Arabidopsis thaliana	Receptor protein-tyrosine kinase CEPR1	41.975%	Swiss-Prot	weak database homology
`Q9SYM9`	Arabidopsis thaliana	Receptor-like serine/threonine-protein kinase At1g78530	39.623%	Swiss-Prot	moderate database homology
`D7UPN3`	Oryza sativa subsp. japonica	LysM domain receptor-like kinase 10	38.144%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card