Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1809 bp · LXL04_027735|LXL04_027735|OH1004|cDNA
ATGATGTGCACAGGGATGtcgaaaaaaataaaaaatgtgcTTGCACTTTTCTGGTTGAAAAGCTggtgcattcgtgtccgcaggatGCGCGCTCGCACACAAGTTCAGGAAACCCAAGCCAATTTGGTTCTTATTTGCACCCCCCCCCCCTGCGCGCAAGAGAGAGCCTCTTTGGTACAAGTCTTACAAATCCTTCAACTGCTCCGCACCGGAGGCGAAGAAATAAATCCAGAGGTGTTAAAAGACTTCAACTGCTCCGC...
1809 bp · LXL04_027735|LXL04_027735|OH1004|CDS
ATGATGTGCACAGGGATGTCGAAAAAAATAAAAAATGTGCTTGCACTTTTCTGGTTGAAAAGCTGGTGCATTCGTGTCCGCAGGATGCGCGCTCGCACACAAGTTCAGGAAACCCAAGCCAATTTGGTTCTTATTTGCACCCCCCCCCCCTGCGCGCAAGAGAGAGCCTCTTTGGTACAAGTCTTACAAATCCTTCAACTGCTCCGCACCGGAGGCGAAGAAATAAATCCAGAGGTGTTAAAAGACTTCAACTGCTCCGC...
Protein
Download Protein FASTA602 aa · LXL04_027735|LXL04_027735|OH1004|PROTEIN
MMCTGMSKKIKNVLALFWLKSWCIRVRRMRARTQVQETQANLVLICTPPPCAQERASLVQVLQILQLLRTGGEEINPEVLKDFNCSAPEEMLKTNSDFHGHSKRFPISINLINLNQRQGLFTQILFNHSTIFTNTNKFALISISGVLGDGFKSSISICVAPLQALKLSTTVLGDGFNSSTSGVLVDICRGKAPHSSNFISVTGMETNHLNRDFSSSPSVFEKSSRPMLGRKELYKNSLRKVAYAWKLINDLNLSEEEVTF...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_027735 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_027735 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:22814440-22819044 (+) | |||||||||
| Description | Similar to ACX1.2: Putative peroxisomal acyl-coenzyme A oxidase 1.2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000038 very long-chain fatty acid metabolic process Biological Process GO:0001676 long-chain fatty acid metabolic process Biological Process GO:0006091 generation of precursor metabolites and energy Biological Process GO:0006629 lipid metabolic process Biological Process GO:0006635 fatty acid beta-oxidation Biological Process GO:0009062 fatty acid catabolic process Biological Process GO:0009611 response to wounding Biological Process GO:0009620 response to fungus Biological Process GO:0009695 jasmonic acid biosynthetic process Biological Process GO:0019395 fatty acid oxidation Biological Process GO:0033540 fatty acid beta-oxidation using acyl-CoA oxidase Biological Process GO:0050665 hydrogen peroxide biosynthetic process Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT2G35690 ath:AT4G16760 cpoc:100135467 ocu:100009549 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14749.12Acyl-CoA_ox_N214-304 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_027735 | PF14749.12 | Acyl-CoA_ox_N | 214 | 304 | 7.9e-23 | 82.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.