LXL04_027625 | RubberDandelionOmics

Gene overview

LXL04_027625

Reference: OH-1004 Chr: Chr06 Coordinates: 20549480-20553057 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2109 bp · LXL04_027625|LXL04_027625|OH1004|cDNA

ATGCTAGATTTGGGGTCGGAGTTTCTGAAGTTGAGTTTTGCTAATTGGGTCGAAAATTTAGGGTTCTTGGAGTTTGATCTGCGTAGTGTCGACTTTTCTAAGTGCATTGGTGAAGCGGTGGGATTTATTGTTGTCGAATCCGTTTTTAATGTTCATAACAATTTGTTTGACTTCACAAGTCAAAGCATACAACCTGATCGCATTAAGAAGTTTTGCACAACTGGTCTCCCAAGTGATATTGTTGTTGAAGTAGAAGATAT...

CDS

Download CDS FASTA

2109 bp · LXL04_027625|LXL04_027625|OH1004|CDS

ATGCTAGATTTGGGGTCGGAGTTTCTGAAGTTGAGTTTTGCTAATTGGGTCGAAAATTTAGGGTTCTTGGAGTTTGATCTGCGTAGTGTCGACTTTTCTAAGTGCATTGGTGAAGCGGTGGGATTTATTGTTGTCGAATCCGTTTTTAATGTTCATAACAATTTGTTTGACTTCACAAGTCAAAGCATACAACCTGATCGCATTAAGAAGTTTTGCACAACTGGTCTCCCAAGTGATATTGTTGTTGAAGTAGAAGATAT...

Protein

Download Protein FASTA

702 aa · LXL04_027625|LXL04_027625|OH1004|PROTEIN

MLDLGSEFLKLSFANWVENLGFLEFDLRSVDFSKCIGEAVGFIVVESVFNVHNNLFDFTSQSIQPDRIKKFCTTGLPSDIVVEVEDMSFHLHKFPLLSRSGVMERLIAEASKQEDKVCTITLPDIPGGAKTFELVAKFCYGVKHEITATNVVHLRCAAEHLHMTEQYGEDNLISQTETFFNQTVLKNWKDSLKSLQTVPNLPLAEDLNITKRCIDSLAVKASTDPNLFGWPVVDHRGPMQSPGGSVLWNGISTGARPKNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027625`
TK1151 ID	TkA07G079290
OH-1004 ID	LXL04_027625
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 98.120 / OH-1004 81.766 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027625

Location Chr06:20549480-20553057 (-)

Description Similar to At1g30440: BTB/POZ domain-containing protein At1g30440

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30440`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g03250`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At3g44820`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g13600`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At5g66560`	May act as a substrate-specific adapter of an E3 ubiquitin-protein ligase complex (CUL3-RBX1-BTB) which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027625 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G30440

ath:AT3G44820

ath:AT5G03250

ath:AT5G13600

ath:AT5G66560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.414

Rank 1 · LXL04_027625 · OH-1004

Cytoplasm0.383

Rank 2 · LXL04_027625 · OH-1004

Cell membrane0.228

Rank 3 · LXL04_027625 · OH-1004

Endoplasmic reticulum0.064

Rank 4 · LXL04_027625 · OH-1004

Golgi apparatus0.055

Rank 5 · LXL04_027625 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00651.38BTB74-165 aa

PF03000.20NPH3263-528 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027625	`PF00651.38`	BTB	74	165	1e-09	39.3
LXL04_027625	`PF03000.20`	NPH3	263	528	4.7e-93	312.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9Q9`	Arabidopsis thaliana	BTB/POZ domain-containing protein At1g30440	71.429%	Swiss-Prot	strong database homology
`Q9LYW0`	Arabidopsis thaliana	BTB/POZ domain-containing protein At5g03250	54.636%	Swiss-Prot	strong database homology
`Q9FYC8`	Arabidopsis thaliana	BTB/POZ domain-containing protein At3g44820	49.655%	Swiss-Prot	moderate database homology
`Q9FNB3`	Arabidopsis thaliana	Putative BTB/POZ domain-containing protein At5g13600	51.034%	Swiss-Prot	strong database homology
`Q94A73`	Arabidopsis thaliana	BTB/POZ domain-containing protein At5g66560	43.263%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card