LXL04_027622 | RubberDandelionOmics

Gene overview

LXL04_027622

Reference: OH-1004 Chr: Chr06 Coordinates: 20507700-20515416 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4965 bp · LXL04_027622|LXL04_027622|OH1004|cDNA

ATGGAAGACGGAGAGGGATCTTCAGAGACGAAGACAAAGACACAGTCTTCAGCTGAGAATGTCAAACCAACAAGAACTGTTATAAAACCAACTGTCTCATCTTCTTTGAAGGTCTCTGGTTCTACTACTGCAACTACACGAAAAAGGATAGAGCCTAAAAGTGTTTCCAAATCTGCCCCTGCCATTAGAAGGAACAGCACCGGGAGTGTACCTGAAAAACAGCAGCAACTTCCAGTTAAGAAACAGATCGGCAgtagtgg...

CDS

Download CDS FASTA

4965 bp · LXL04_027622|LXL04_027622|OH1004|CDS

ATGGAAGACGGAGAGGGATCTTCAGAGACGAAGACAAAGACACAGTCTTCAGCTGAGAATGTCAAACCAACAAGAACTGTTATAAAACCAACTGTCTCATCTTCTTTGAAGGTCTCTGGTTCTACTACTGCAACTACACGAAAAAGGATAGAGCCTAAAAGTGTTTCCAAATCTGCCCCTGCCATTAGAAGGAACAGCACCGGGAGTGTACCTGAAAAACAGCAGCAACTTCCAGTTAAGAAACAGATCGGCAGTAGTGG...

Protein

Download Protein FASTA

1654 aa · LXL04_027622|LXL04_027622|OH1004|PROTEIN

MEDGEGSSETKTKTQSSAENVKPTRTVIKPTVSSSLKVSGSTTATTRKRIEPKSVSKSAPAIRRNSTGSVPEKQQQLPVKKQIGSSGGGGGLTVGRKTSSSTTEPMRRSLPEIRKSSLPSSTVVRASKGQSSPSLSSSSRNLSTSIDSTASSTTRKSTSKLSSLARSSAVSSGSKSGSLSSSREKMSTASSQRKAATPEFRVSRLIMLPQVETKANDDVRLDLRGHRIRSLNAGLKLSPSLEFVYLRDNLLSSLEGIEIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027622`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027622

Location Chr06:20507700-20515416 (+)

Description Similar to AIR9: 187-kDa microtubule-associated protein AIR9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34680`	Microtubule-associated protein that may be involved in the maturation of cell plates and proper insertion of cross-walls after cytokinesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027622 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007059 chromosome segregation Biological Process

GO:0009733 response to auxin Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0023052 signaling Biological Process

GO:0045842 positive regulation of mitotic metaphase/anaphase transition Biological Process

GO:0051301 cell division Biological Process

GO:1901970 positive regulation of mitotic sister chromatid separation Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT2G34680

lmo:lmo0263

mmu:66385

spo:2543597

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.701

Rank 1 · LXL04_027622 · OH-1004

Nucleus0.274

Rank 2 · LXL04_027622 · OH-1004

Cell membrane0.120

Rank 3 · LXL04_027622 · OH-1004

Mitochondrion0.061

Rank 4 · LXL04_027622 · OH-1004

Endoplasmic reticulum0.051

Rank 5 · LXL04_027622 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14580.13LRR_9214-319 aa

PF13855.13LRR_8262-319 aa

PF12799.14LRR_4285-323 aa

PF23197.2IG_AIR9476-526 aa

PF23197.2IG_AIR9543-629 aa

PF23197.2IG_AIR9639-725 aa

PF23197.2IG_AIR9734-826 aa

PF23197.2IG_AIR9837-923 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027622	`PF14580.13`	LRR_9	214	319	1.5e-07	31.9
LXL04_027622	`PF13855.13`	LRR_8	262	319	8.5e-10	39.0
LXL04_027622	`PF12799.14`	LRR_4	285	323	8.6e-21	74.2
LXL04_027622	`PF23197.2`	IG_AIR9	476	526	3.9e-215	697.2
LXL04_027622	`PF23197.2`	IG_AIR9	543	629	3.9e-215	697.2
LXL04_027622	`PF23197.2`	IG_AIR9	639	725	3.9e-215	697.2
LXL04_027622	`PF23197.2`	IG_AIR9	734	826	3.9e-215	697.2
LXL04_027622	`PF23197.2`	IG_AIR9	837	923	3.9e-215	697.2
LXL04_027622	`PF23197.2`	IG_AIR9	937	1015	3.9e-215	697.2
LXL04_027622	`PF23197.2`	IG_AIR9	1031	1113	3.9e-215	697.2
LXL04_027622	`PF23197.2`	IG_AIR9	1128	1218	3.9e-215	697.2
LXL04_027622	`PF23197.2`	IG_AIR9	1241	1309	3.9e-215	697.2
LXL04_027622	`PF23197.2`	IG_AIR9	1430	1515	3.9e-215	697.2
LXL04_027622	`PF23218.2`	PH_AIR9	1545	1641	3e-52	175.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IIU4`	Arabidopsis thaliana	187-kDa microtubule-associated protein AIR9	63.049%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card