LXL04_027612 | RubberDandelionOmics

Gene overview

LXL04_027612

Reference: OH-1004 Chr: Chr06 Coordinates: 20202098-20204318 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1083 bp · LXL04_027612|LXL04_027612|OH1004|cDNA

ATGGCAAGAAAAAATCTGGGCTGTTCATCATCActatttcttgttcttctagCAGTTGGTTCATTCTTTGCTACTTATAATCTAATCACATTGGTGGTTCACAATAAAGCAGCAAATCATGGACAATATACTTATGATCCACTTGTTGTGATGCCTGATAATATGAAGAGAACCGGGGGTAAAAAGGTCTTATTCCATGTTGCACTCACAGCTACAGATGCTCCTTACAGCAAATGGCAATGCAGGATTATGTATTATTG...

CDS

Download CDS FASTA

1083 bp · LXL04_027612|LXL04_027612|OH1004|CDS

ATGGCAAGAAAAAATCTGGGCTGTTCATCATCACTATTTCTTGTTCTTCTAGCAGTTGGTTCATTCTTTGCTACTTATAATCTAATCACATTGGTGGTTCACAATAAAGCAGCAAATCATGGACAATATACTTATGATCCACTTGTTGTGATGCCTGATAATATGAAGAGAACCGGGGGTAAAAAGGTCTTATTCCATGTTGCACTCACAGCTACAGATGCTCCTTACAGCAAATGGCAATGCAGGATTATGTATTATTG...

Protein

Download Protein FASTA

360 aa · LXL04_027612|LXL04_027612|OH1004|PROTEIN

MARKNLGCSSSLFLVLLAVGSFFATYNLITLVVHNKAANHGQYTYDPLVVMPDNMKRTGGKKVLFHVALTATDAPYSKWQCRIMYYWYKKTKDMEGSEMGKFTRILHSGQPDNLMDEIPTFVVDPLPSGLDRGYIVLNRPWAFVQWLEKATIEEDYILMAEPDHIFVNPLPNLARGGHPAAFPFFYIEPEKNEKVIRKYYPVENGPVNNVDPIGNSPVIIRKDLLEKIAPTWMNVSLRMKDDPETDKTFGWVLEMYAYAV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027612`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027612

Location Chr06:20202098-20204318 (+)

Description Similar to HPAT3: Hydroxyproline O-arabinosyltransferase 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13500`	Glycosyltransferase involved in the O-arabinosylation of several proteins including extensins and small signaling peptides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027612 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:1990585 hydroxyproline O-arabinosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT5G13500

mtr:11432343

mtr:11443987

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.788

Rank 1 · LXL04_027612 · OH-1004

Endoplasmic reticulum0.158

Rank 2 · LXL04_027612 · OH-1004

Cytoplasm0.072

Rank 3 · LXL04_027612 · OH-1004

Cell membrane0.049

Rank 4 · LXL04_027612 · OH-1004

Extracellular0.043

Rank 5 · LXL04_027612 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23452.3HPAT65-270 aa

PF28609.1HPAT_C289-358 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027612	`PF23452.3`	HPAT	65	270	8.3e-91	304.4
LXL04_027612	`PF28609.1`	HPAT_C	289	358	4e-30	104.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY51`	Arabidopsis thaliana	Hydroxyproline O-arabinosyltransferase 3	78.171%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card