LXL04_027596 | RubberDandelionOmics

Gene overview

LXL04_027596

Reference: OH-1004 Chr: Chr06 Coordinates: 19846576-19850318 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

505 bp · LXL04_027596|LXL04_027596|OH1004|cDNA

TTCAAAGGCCACGTCTTGAACTATGTCTTTCACCTTTCAAACACTCCTTCTTGCACCAAGTTACCTATATGTGGTGATGGTTGGAGTAGGGGCAGAAGACACACTATTGTCACCACCCGAAGGCAACATGACTTTTTTGGATGGTACAAATTGGTGTGTTGCTTCACCCGGTGCATCCCAAACCGATTTACAAAATGCATTAGATTGGGCATGTGGATTAGGTATGGCTGATTGTAGCCAAATCAAACCTGGAGGCCCGT...

CDS

Download CDS FASTA

483 bp · LXL04_027596|LXL04_027596|OH1004|CDS

ATGTCTTTCACCTTTCAAACACTCCTTCTTGCACCAAGTTACCTATATGTGGTGATGGTTGGAGTAGGGGCAGAAGACACACTATTGTCACCACCCGAAGGCAACATGACTTTTTTGGATGGTACAAATTGGTGTGTTGCTTCACCCGGTGCATCCCAAACCGATTTACAAAATGCATTAGATTGGGCATGTGGATTAGGTATGGCTGATTGTAGCCAAATCAAACCTGGAGGCCCGTGTTTTGAACCCGACACACTATT...

Protein

Download Protein FASTA

160 aa · LXL04_027596|LXL04_027596|OH1004|PROTEIN

MSFTFQTLLLAPSYLYVVMVGVGAEDTLLSPPEGNMTFLDGTNWCVASPGASQTDLQNALDWACGLGMADCSQIKPGGPCFEPDTLFSHASFAFNSYYQQNGNSDVACNFGGSATLTKNDPSYGKCSYIAAELAKSEGASIWKLNWWKSGGIVLLLYMGS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027596`
TK1151 ID	TkA07G076990
OH-1004 ID	LXL04_027596
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 73.653 / OH-1004 76.875 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027596

Location Chr06:19846576-19850318 (+)

Description Similar to At5g56590: Glucan endo-1,3-beta-glucosidase 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g56590`	Glucan endo-1,3-beta-glucosidase 13.	No verified direct reference in this release
`At4g29360`	Glucan endo-1,3-beta-glucosidase 12.	No verified direct reference in this release
`At1g66250`	Glucan endo-1,3-beta-glucosidase 2.	No verified direct reference in this release
`At1g11820`	Glucan endo-1,3-beta-glucosidase 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027596 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0098552 side of membrane Cellular Component

GO:0042973 glucan endo-1,3-beta-D-glucosidase activity Molecular Function

KEGG gene cross-reference

ath:AT1G11820

ath:AT1G66250

ath:AT4G29360

ath:AT5G56590

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.629

Rank 1 · LXL04_027596 · OH-1004

Endoplasmic reticulum0.107

Rank 2 · LXL04_027596 · OH-1004

Extracellular0.095

Rank 3 · LXL04_027596 · OH-1004

Cytoplasm0.084

Rank 4 · LXL04_027596 · OH-1004

Lysosome / Vacuole0.079

Rank 5 · LXL04_027596 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07983.19X844-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027596	`PF07983.19`	X8	44	115	1.9e-24	86.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJU9`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 13	62.500%	Swiss-Prot	moderate database homology
`Q8VYE5`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 12	59.091%	Swiss-Prot	moderate database homology
`Q9C7U5`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 2	48.077%	Swiss-Prot	moderate database homology
`O65399`	Arabidopsis thaliana	Glucan endo-1,3-beta-glucosidase 1	49.495%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card