LXL04_027552 | RubberDandelionOmics

Gene overview

LXL04_027552

Reference: OH-1004 Chr: Chr06 Coordinates: 18837713-18841041 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2187 bp · LXL04_027552|LXL04_027552|OH1004|cDNA

atggATTTGAGTTCGTTTATCACTTCATTGGCTACTTCGTTCGTGATCTTTGTGTTTCTGATGATTTTGTTCGCTTGGTTGAGCACGAAACCAGGTAACGCCGTTATTTATTACCCGAATCGGATCCTTAAAGGTATGGATCCATGGGAGGGAAGCAGTTCGAAGACGAGGAATCCGTTTGCTTGGATCCGTGAagctttttcttcttctgaacAAGATGTTATTGCCATGTCTGGTGTTGATTCTGCTGTTTACTTCGT...

CDS

Download CDS FASTA

2187 bp · LXL04_027552|LXL04_027552|OH1004|CDS

ATGGATTTGAGTTCGTTTATCACTTCATTGGCTACTTCGTTCGTGATCTTTGTGTTTCTGATGATTTTGTTCGCTTGGTTGAGCACGAAACCAGGTAACGCCGTTATTTATTACCCGAATCGGATCCTTAAAGGTATGGATCCATGGGAGGGAAGCAGTTCGAAGACGAGGAATCCGTTTGCTTGGATCCGTGAAGCTTTTTCTTCTTCTGAACAAGATGTTATTGCCATGTCTGGTGTTGATTCTGCTGTTTACTTCGT...

Protein

Download Protein FASTA

728 aa · LXL04_027552|LXL04_027552|OH1004|PROTEIN

MDLSSFITSLATSFVIFVFLMILFAWLSTKPGNAVIYYPNRILKGMDPWEGSSSKTRNPFAWIREAFSSSEQDVIAMSGVDSAVYFVFLGTVFGIFLISGIVLLPILLPVAFTEHNPKAVDSTGKNAFNDLDKLSMAHIKEQGSRLFASAFACYWVSFTTYFLLWKAYKHVSDMRAAALMTPEVRAEQFAILVRDIPSSADGLSRKQQIDTYFKNIYPERFYKSLVVTDNKEVSKIHDELVLCKKKLTRAETIKSMNPEG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027552`
TK1151 ID	TkA07G072940
OH-1004 ID	LXL04_027552
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027552

Location Chr06:18837713-18841041 (+)

Description Similar to ERD4: CSC1-like protein ERD4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30360`	May act as a hyperosmolarity-gated nonselective cation channel permeable to Ca²⁺.	Structure-guided mutagenesis of OSCAs reveals differential activation to mechanical stimuli.2024 · DOI: 10.7554/elife.93147
`At4g02900`	Calcium-permeable channel involved in plant stomatal immunity.	No verified direct reference in this release
`At1g32090`	Acts as an osmosensitive calcium-permeable cation channel.	No verified direct reference in this release
`At1g11960`	Calcium-permeable channel that plays a key role in plant stomatal immunity.	The calcium-permeable channel OSCA1.3 regulates plant stomatal immunity.2020 · DOI: 10.1038/s41586-020-2702-1

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027552 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010118 stomatal movement Biological Process

GO:0045087 innate immune response Biological Process

GO:0140426 pathogen-associated molecular pattern receptor signaling pathway Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT1G11960

ath:AT1G30360

ath:AT1G32090

ath:AT4G02900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.767

Rank 1 · LXL04_027552 · OH-1004

Cytoplasm0.119

Rank 2 · LXL04_027552 · OH-1004

Endoplasmic reticulum0.095

Rank 3 · LXL04_027552 · OH-1004

Lysosome / Vacuole0.066

Rank 4 · LXL04_027552 · OH-1004

Golgi apparatus0.050

Rank 5 · LXL04_027552 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13967.12RSN1_TM5-166 aa

PF14703.13PHM7_cyt188-350 aa

PF02714.21RSN1_7TM361-632 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027552	`PF13967.12`	RSN1_TM	5	166	1.4e-32	113.3
LXL04_027552	`PF14703.13`	PHM7_cyt	188	350	3.7e-32	112.6
LXL04_027552	`PF02714.21`	RSN1_7TM	361	632	1.6e-85	287.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C8G5`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 3.1	62.069%	Swiss-Prot	strong database homology
`Q9SY14`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 1.7	30.453%	Swiss-Prot	moderate database homology
`Q9FVQ5`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 1.8	33.333%	Swiss-Prot	moderate database homology
`B5TYT3`	Arabidopsis thaliana	Hyperosmolality-gated Ca2+ permeable channel 1.3	30.641%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card