LXL04_027507 | RubberDandelionOmics

Gene overview

LXL04_027507

Reference: OH-1004 Chr: Chr06 Coordinates: 17593148-17597530 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1728 bp · LXL04_027507|LXL04_027507|OH1004|cDNA

ATGGAAGGAGGCATACATCCGGCGGACCCATCGGCGTTCCGGGAATGTTTTTCCCTGGCATGGAAGAACCCATACGTTCTTCGTCTTGCTTTCTCTGCCGGTATCGGTGGACTTCTATTTGGTTACGATACAGGGGTGATATCTGGAGCACTTCTTTACATCAGGGACGACTTCGAGGCTGTAGATAAGAAGACTGTTTTGCAGGAGAGCATTGTGAGTATGGCACTTGCTGGAGCAATCGTGGGAGCGGCTATTGGAGG...

CDS

Download CDS FASTA

1728 bp · LXL04_027507|LXL04_027507|OH1004|CDS

ATGGAAGGAGGCATACATCCGGCGGACCCATCGGCGTTCCGGGAATGTTTTTCCCTGGCATGGAAGAACCCATACGTTCTTCGTCTTGCTTTCTCTGCCGGTATCGGTGGACTTCTATTTGGTTACGATACAGGGGTGATATCTGGAGCACTTCTTTACATCAGGGACGACTTCGAGGCTGTAGATAAGAAGACTGTTTTGCAGGAGAGCATTGTGAGTATGGCACTTGCTGGAGCAATCGTGGGAGCGGCTATTGGAGG...

Protein

Download Protein FASTA

575 aa · LXL04_027507|LXL04_027507|OH1004|PROTEIN

MEGGIHPADPSAFRECFSLAWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDFEAVDKKTVLQESIVSMALAGAIVGAAIGGWLNDRKGRKFALLVADFLFFIGAILMAAAPNPAVLIVGRIFVGLGVGMASMTAPLYISEASPAKVRGALVSTNGFLITGGQFLSYLINLAFTKAPGTWRWMLGVAGLPALLQFVLMLALPESPRWLYRKGREEEAITILRKIYPAGDVDAEIEALKESVEQEVEETGSSEKIN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027507`
TK1151 ID	TkA07G068870
OH-1004 ID	LXL04_027507
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.442 / OH-1004 66.261 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027507

Location Chr06:17593148-17597530 (-)

Description Similar to INT2: Probable inositol transporter 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g30220`	Plasma membrane inositol-proton symporter.	Arabidopsis INOSITOL TRANSPORTER2 mediates H+ symport of different inositol epimers and derivatives across the plasma membrane.2007 · DOI: 10.1104/pp.107.109033
`At4g16480`	Plasma membrane inositol-proton symporter.	Arabidopsis INOSITOL TRANSPORTER4 mediates high-affinity H+ symport of myoinositol across the plasma membrane.2006 · DOI: 10.1104/pp.106.077123 Arabidopsis INOSITOL TRANSPORTER2 mediates H+ symport of different inositol epimers and derivatives across the plasma membrane.2007 · DOI: 10.1104/pp.107.109033
`At2g35740`	Plasma membrane inositol-proton symporter.	Arabidopsis INOSITOL TRANSPORTER2 mediates H+ symport of different inositol epimers and derivatives across the plasma membrane.2007 · DOI: 10.1104/pp.107.109033
`At2g43330`	Vacuolar inositol-proton symporter involved in the release of myo-inositol from vacuoles.	Functional and physiological characterization of Arabidopsis INOSITOL TRANSPORTER1, a novel tonoplast-localized transporter for myo-inositol.2008 · DOI: 10.1105/tpc.107.055632

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027507 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015798 myo-inositol transport Biological Process

GO:0023052 signaling Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0005366 myo-inositol:proton symporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G30220

ath:AT2G35740

ath:AT2G43330

ath:AT4G16480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.724

Rank 1 · LXL04_027507 · OH-1004

Cytoplasm0.156

Rank 2 · LXL04_027507 · OH-1004

Lysosome / Vacuole0.088

Rank 3 · LXL04_027507 · OH-1004

Mitochondrion0.054

Rank 4 · LXL04_027507 · OH-1004

Endoplasmic reticulum0.052

Rank 5 · LXL04_027507 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083.31Sugar_tr30-359 aa

PF07690.22MFS_135-358 aa

PF00083.31Sugar_tr446-551 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027507	`PF00083.31`	Sugar_tr	30	359	1.7e-122	410.3
LXL04_027507	`PF07690.22`	MFS_1	35	358	3.5e-33	115.7
LXL04_027507	`PF00083.31`	Sugar_tr	446	551	1.7e-122	410.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C757`	Arabidopsis thaliana	Probable inositol transporter 2	76.000%	Swiss-Prot	strong database homology
`O23492`	Arabidopsis thaliana	Inositol transporter 4	61.854%	Swiss-Prot	strong database homology
`Q9ZQP6`	Arabidopsis thaliana	Probable inositol transporter 3	59.665%	Swiss-Prot	strong database homology
`Q8VZR6`	Arabidopsis thaliana	Inositol transporter 1	59.710%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card