LXL04_027243 | RubberDandelionOmics

Gene overview

LXL04_027243

Reference: OH-1004 Chr: Chr06 Coordinates: 11637227-11638007 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · LXL04_027243|LXL04_027243|OH1004|cDNA

ATGGAAAGAAGCTCCAACGGATTATGGTATACTCTATTCAATTTAGTCGTCTGCTTCATCTCATTTTCTGAATCAGTCCATCTCCCCGGCGTTGCTTCCCGTGATTATCAAAGGGGTGATCATCTTCAAGTTAAAGTCAACAAGCTTTCTTCTACGAAAACACGAATTCCTCATGAGTACTATTACTTGAACTACTGTAAATCTAAGCACGTTGAAAACAGTACTGAAACTGAGAATTCGGTCTACACGTTTCTTATGAG...

CDS

Download CDS FASTA

360 bp · LXL04_027243|LXL04_027243|OH1004|CDS

ATGGAAAGAAGCTCCAACGGATTATGGTATACTCTATTCAATTTAGTCGTCTGCTTCATCTCATTTTCTGAATCAGTCCATCTCCCCGGCGTTGCTTCCCGTGATTATCAAAGGGGTGATCATCTTCAAGTTAAAGTCAACAAGCTTTCTTCTACGAAAACACGAATTCCTCATGAGTACTATTACTTGAACTACTGTAAATCTAAGCACGTTGAAAACAGTACTGAAACTGAGAATTCGGTCTACACGTTTCTTATGAG...

Protein

Download Protein FASTA

119 aa · LXL04_027243|LXL04_027243|OH1004|PROTEIN

MERSSNGLWYTLFNLVVCFISFSESVHLPGVASRDYQRGDHLQVKVNKLSSTKTRIPHEYYYLNYCKSKHVENSTETENSVYTFLMREEQPCKVACRVKLDAEFSKKFKEIIDDEYRVN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027243`
TK1151 ID	TkA07G041220
OH-1004 ID	LXL04_027243
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027243

Location Chr06:11637227-11638007 (-)

Description Similar to TMN7: Transmembrane 9 superfamily member 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13772`	May play a role as effector of cellular copper homeostasis.	Transmembrane nine proteins in yeast and Arabidopsis affect cellular metal contents without changing vacuolar morphology.2010 · DOI: 10.1111/j.1399-3054.2010.01404.x
`At1g55130`	Transmembrane 9 superfamily member 6.	No verified direct reference in this release
`At2g24170`	Transmembrane 9 superfamily member 10.	No verified direct reference in this release
`At5g25100`	Transmembrane 9 superfamily member 9.	No verified direct reference in this release
`At5g10840`	Transmembrane 9 superfamily member 8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027243 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006811 monoatomic ion transport Biological Process

GO:0006878 intracellular copper ion homeostasis Biological Process

GO:0006882 intracellular zinc ion homeostasis Biological Process

GO:0072657 protein localization to membrane Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

KEGG gene cross-reference

ath:AT1G55130

ath:AT2G24170

ath:AT3G13772

ath:AT5G10840

ath:AT5G25100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.364

Rank 1 · LXL04_027243 · OH-1004

Extracellular0.226

Rank 2 · LXL04_027243 · OH-1004

Golgi apparatus0.169

Rank 3 · LXL04_027243 · OH-1004

Lysosome / Vacuole0.168

Rank 4 · LXL04_027243 · OH-1004

Cytoplasm0.148

Rank 5 · LXL04_027243 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIC2`	Arabidopsis thaliana	Transmembrane 9 superfamily member 7	60.952%	Swiss-Prot	strong database homology
`Q9C720`	Arabidopsis thaliana	Transmembrane 9 superfamily member 6	54.237%	Swiss-Prot	strong database homology
`Q8RWW1`	Arabidopsis thaliana	Transmembrane 9 superfamily member 10	50.413%	Swiss-Prot	strong database homology
`Q9C5N2`	Arabidopsis thaliana	Transmembrane 9 superfamily member 9	47.244%	Swiss-Prot	moderate database homology
`F4KIB2`	Arabidopsis thaliana	Transmembrane 9 superfamily member 8	47.826%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card