LXL04_027235 | RubberDandelionOmics

Gene overview

LXL04_027235

Reference: OH-1004 Chr: Chr06 Coordinates: 11454116-11454825 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

630 bp · LXL04_027235|LXL04_027235|OH1004|cDNA

ATGGGACTCTTCATGAAACATATGGCTTTCGTTGATTTATCTATAAACCCATTTATGGAGAGTGAGATTCCGAGTGATATCGGGAAGCTTGTGAAACTTCAGCATCTTACCCTCCATACAAACAATTTCAACGGAACGCTACCGAATACCTCCGTCGCTAATTGCGTCAATCTCGAAAGATTAGAGCTTCAAAACAACGGGTTTCATGGCGATTTTCCGATCAAGCTATGGTCGTTGCCTAAAATCAAGGTAATTAGAGC...

CDS

Download CDS FASTA

630 bp · LXL04_027235|LXL04_027235|OH1004|CDS

ATGGGACTCTTCATGAAACATATGGCTTTCGTTGATTTATCTATAAACCCATTTATGGAGAGTGAGATTCCGAGTGATATCGGGAAGCTTGTGAAACTTCAGCATCTTACCCTCCATACAAACAATTTCAACGGAACGCTACCGAATACCTCCGTCGCTAATTGCGTCAATCTCGAAAGATTAGAGCTTCAAAACAACGGGTTTCATGGCGATTTTCCGATCAAGCTATGGTCGTTGCCTAAAATCAAGGTAATTAGAGC...

Protein

Download Protein FASTA

209 aa · LXL04_027235|LXL04_027235|OH1004|PROTEIN

MGLFMKHMAFVDLSINPFMESEIPSDIGKLVKLQHLTLHTNNFNGTLPNTSVANCVNLERLELQNNGFHGDFPIKLWSLPKIKVIRAENNRFSGEIPDSISTSSQLEQVQIDNNSFIGKIPHGLGMVKSLYRFSTSLNGLYGELLLNFCDSPVMSIINFSHSYITGEIPELKQCKKLVSLSLADNNFIDEFQFSIEVQRVPEGSRERKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027235`
TK1151 ID	TkA07G040790
OH-1004 ID	LXL04_027235
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	80.300
Protein coverage (%)	TK1151 96.680 / OH-1004 98.565 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027235

Location Chr06:11454116-11454825 (-)

Description Similar to At5g06940: Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06940`	Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940.	No verified direct reference in this release
`At1g09970`	Plays a role in pattern-triggered immunity (PTI) signaling induced by pathogen-associated molecular patterns (PAMPs).	RLK7, a leucine-rich repeat receptor-like kinase, is required for proper germination speed and tolerance to oxidative stress in Arabidopsis thaliana.2010 · DOI: 10.1007/s00425-010-1260-4 The secreted peptide PIP1 amplifies immunity through receptor-like kinase 7.2014 · DOI: 10.1371/journal.ppat.1004331
`At1g72180`	Receptor kinase involved in the perception of C-terminally encoded plant signaling peptide (CEP) and subsequent regulation of root and shoot development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0618700`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	Analysis of flagellin perception mediated by flg22 receptor OsFLS2 in rice.2008 · DOI: 10.1094/mpmi-21-12-1635 Rice OsFLS2-Mediated Perception of Bacterial Flagellins Is Evaded by Xanthomonas oryzae pvs. oryzae and oryzicola.2015 · DOI: 10.1016/j.molp.2015.01.012
`Os04g0576900`	Functions in the early stages of organ development by regulating cell division rate.	XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassinosteroids and cell cycling in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04877.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027235 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009845 seed germination Biological Process

GO:0045087 innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0001653 peptide receptor activity Molecular Function

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0042277 peptide binding Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G09970

ath:AT5G06940

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.395

Rank 1 · LXL04_027235 · OH-1004

Extracellular0.258

Rank 2 · LXL04_027235 · OH-1004

Endoplasmic reticulum0.120

Rank 3 · LXL04_027235 · OH-1004

Cytoplasm0.080

Rank 4 · LXL04_027235 · OH-1004

Nucleus0.055

Rank 5 · LXL04_027235 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12799.14LRR_4157-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027235	`PF12799.14`	LRR_4	157	192	5.4e-12	46.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL51`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase At5g06940	57.368%	Swiss-Prot	strong database homology
`F4I2N7`	Arabidopsis thaliana	Receptor-like protein kinase 7	32.512%	Swiss-Prot	moderate database homology
`Q9C7T7`	Arabidopsis thaliana	Receptor protein-tyrosine kinase CEPR2	37.097%	Swiss-Prot	moderate database homology
`Q0JA29`	Oryza sativa subsp. japonica	LRR receptor-like serine/threonine-protein kinase FLS2	33.810%	Swiss-Prot	moderate database homology
`G9LZD7`	Oryza sativa subsp. japonica	Probable inactive leucine-rich repeat receptor kinase XIAO	29.493%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card