LXL04_027222 | RubberDandelionOmics

Gene overview

LXL04_027222

Reference: OH-1004 Chr: Chr06 Coordinates: 11281168-11291979 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1707 bp · LXL04_027222|LXL04_027222|OH1004|cDNA

ATGGATGAAATTAAGTACAATTACATCGTAGTTGACGGGTTAAAGCTCCATGTTGCTGAAATTGGGTCTGAATCATCACCGGCGGTACTTTTTCTCTACGGGTTTCCGGAAATATGGTACACATGGCGCCATCAAATGATTGCTGTCGCAAATGCCGGTTTTAGAGCCATCACACCCGATTACAGAGGGTACGGACTATCGGATGTCCCAGCAGAACCCGAGAAAACCTCATTTGTTGATCTGGTGAAAGATACTGCCTC...

CDS

Download CDS FASTA

1707 bp · LXL04_027222|LXL04_027222|OH1004|CDS

ATGGATGAAATTAAGTACAATTACATCGTAGTTGACGGGTTAAAGCTCCATGTTGCTGAAATTGGGTCTGAATCATCACCGGCGGTACTTTTTCTCTACGGGTTTCCGGAAATATGGTACACATGGCGCCATCAAATGATTGCTGTCGCAAATGCCGGTTTTAGAGCCATCACACCCGATTACAGAGGGTACGGACTATCGGATGTCCCAGCAGAACCCGAGAAAACCTCATTTGTTGATCTGGTGAAAGATACTGCCTC...

Protein

Download Protein FASTA

568 aa · LXL04_027222|LXL04_027222|OH1004|PROTEIN

MDEIKYNYIVVDGLKLHVAEIGSESSPAVLFLYGFPEIWYTWRHQMIAVANAGFRAITPDYRGYGLSDVPAEPEKTSFVDLVKDTASILNYLAISKVFVIGKDFGAMVGYTFALFYPEKVAGVATLGVPFMSPDALKGHESLPEGFYMRRWLEPGRAEADFGRFDAKTVVKNIYILFSKSEIPIASENQEIMDLVDPTTPLPSWFTEEDLSIFGALYARSGFQTALQVPYRAFLEKSESPPTSPKVEAPALFIMGEKDMV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027222`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_027222`
Location	Chr06:11281168-11291979 (+)
Description	Similar to EPHX2: Bifunctional epoxide hydrolase 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027222` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0004301 epoxide hydrolase activity Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.822

Rank 1 · LXL04_027222 · OH-1004

Nucleus0.205

Rank 2 · LXL04_027222 · OH-1004

Endoplasmic reticulum0.061

Rank 3 · LXL04_027222 · OH-1004

Mitochondrion0.058

Rank 4 · LXL04_027222 · OH-1004

Peroxisome0.053

Rank 5 · LXL04_027222 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00561.27Abhydrolase_127-287 aa

PF12146.16Hydrolase_427-127 aa

PF12697.14Abhydrolase_637-294 aa

PF03096.21Ndr68-123 aa

PF12146.16Hydrolase_4314-415 aa

PF00561.27Abhydrolase_1315-420 aa

PF12697.14Abhydrolase_6317-557 aa

PF20408.5Abhydrolase_11369-429 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027222	`PF00561.27`	Abhydrolase_1	27	287	2.5e-47	162.3
LXL04_027222	`PF12146.16`	Hydrolase_4	27	127	2.3e-21	77.0
LXL04_027222	`PF12697.14`	Abhydrolase_6	37	294	1.5e-25	91.8
LXL04_027222	`PF03096.21`	Ndr	68	123	1.3e-09	38.0
LXL04_027222	`PF12146.16`	Hydrolase_4	314	415	2.3e-21	77.0
LXL04_027222	`PF00561.27`	Abhydrolase_1	315	420	2.5e-47	162.3
LXL04_027222	`PF12697.14`	Abhydrolase_6	317	557	1.5e-25	91.8
LXL04_027222	`PF20408.5`	Abhydrolase_11	369	429	7.8e-10	39.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card