LXL04_027214 | RubberDandelionOmics

Gene overview

LXL04_027214

Reference: OH-1004 Chr: Chr06 Coordinates: 11193025-11198032 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2574 bp · LXL04_027214|LXL04_027214|OH1004|cDNA

ATGCGGAAAAAGGATTCACCTTCGTGTGGATGCTTCGGCTCGCTCTTCCAAAAGAAACCTTCAGGATCTGGGAAAGGGAAAAGTACCTCGGGGAGGAGTAGAATCATTCGGGCTGCAAGTAATCACCTTGTGAGCAGCAGTAGGAAGAAATCTGGATCATCAAAAAAAGCTCAATCATCCACAAATGGGTTGGTGCAGAAGTCTCATAGTGTATCTGATAATTCTGAGCTTCAAAAGAAGATCATAAGCTTTAGAGAGCT...

CDS

Download CDS FASTA

2574 bp · LXL04_027214|LXL04_027214|OH1004|CDS

ATGCGGAAAAAGGATTCACCTTCGTGTGGATGCTTCGGCTCGCTCTTCCAAAAGAAACCTTCAGGATCTGGGAAAGGGAAAAGTACCTCGGGGAGGAGTAGAATCATTCGGGCTGCAAGTAATCACCTTGTGAGCAGCAGTAGGAAGAAATCTGGATCATCAAAAAAAGCTCAATCATCCACAAATGGGTTGGTGCAGAAGTCTCATAGTGTATCTGATAATTCTGAGCTTCAAAAGAAGATCATAAGCTTTAGAGAGCT...

Protein

Download Protein FASTA

857 aa · LXL04_027214|LXL04_027214|OH1004|PROTEIN

MRKKDSPSCGCFGSLFQKKPSGSGKGKSTSGRSRIIRAASNHLVSSSRKKSGSSKKAQSSTNGLVQKSHSVSDNSELQKKIISFRELVNFPPSIGSLTIIELVIDTVKELHKLHPDVVRCGSVSDMDSGAMNKAINLLCESIKSLGKHWMHGDEWMVRSKKDYEASNGDLEKHAMDLLDDIINVARERMINKTDMDDDNDDDDKEIKEEAESPSTSSRRSNFDKERCSSSPTTPTSVLPELPINKSAKACSKVTYPPPMD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027214`
TK1151 ID	TkA07G040090
OH-1004 ID	LXL04_027214
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.400
Protein coverage (%)	TK1151 81.917 / OH-1004 54.026 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027214

Location Chr06:11193025-11198032 (+)

Description Similar to At4g04980: Uncharacterized protein At4g04980

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04980`	Uncharacterized protein At4g04980.	No verified direct reference in this release
`At1g07120`	Microtubule-associated protein probably involved in the regulation of microtubule organization.	No verified direct reference in this release
`At1g48280`	Microtubule-associated protein probably involved in the regulation of microtubule organization.	No verified direct reference in this release
`At3g25690`	Required for the positioning and movement of chloroplasts.	Chloroplast unusual positioning1 is essential for proper chloroplast positioning.2003 · DOI: 10.1105/tpc.016428 Chloroplast outer envelope protein CHUP1 is essential for chloroplast anchorage to the plasma membrane and chloroplast movement.2008 · DOI: 10.1104/pp.108.123075

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027214 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0072699 protein localization to cortical microtubule cytoskeleton Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0009986 cell surface Cellular Component

GO:0055028 cortical microtubule Cellular Component

GO:0003824 catalytic activity Molecular Function

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

ath:AT1G48280

ath:AT4G04980

bpe:BP1879

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.530

Rank 1 · LXL04_027214 · OH-1004

Cytoplasm0.359

Rank 2 · LXL04_027214 · OH-1004

Nucleus0.264

Rank 3 · LXL04_027214 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_027214 · OH-1004

Golgi apparatus0.037

Rank 5 · LXL04_027214 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28571.1At4g04980_N108-186 aa

PF26700.1IPGAL1_C716-852 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027214	`PF28571.1`	At4g04980_N	108	186	1.2e-17	64.4
LXL04_027214	`PF26700.1`	IPGAL1_C	716	852	8.6e-06	26.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q1PEB4`	Arabidopsis thaliana	Uncharacterized protein At4g04980	47.074%	Swiss-Prot	weak database homology
`Q9LMK4`	Arabidopsis thaliana	INCREASED PETAL GROWTH ANISOTROPY 1-like protein 1	23.810%	Swiss-Prot	weak database homology
`Q9SX62`	Arabidopsis thaliana	INCREASED PETAL GROWTH ANISOTROPY 1-like protein 2	23.577%	Swiss-Prot	weak database homology
`Q9LI74`	Arabidopsis thaliana	Protein CHUP1, chloroplastic	25.610%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card