RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_027198
Reference: OH-1004 Chr: Chr06 Coordinates: 10896991-10902125 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3036 bp · LXL04_027198|LXL04_027198|OH1004|cDNA

ATGAATACTGACCAAATAGGCTTATTGTACAGAGGGATGTCCAGATTCCAGGGAAATACTGGCATTCTTGGTGGCACTGCAAAGGAATTTGTCGCTCATTCGGCAAACGTGAACTGTTTGAAAATCGGGAAGAAGACACATCGAAACTTCATCACAGGTGGCGACGATGAAAAAGTAAATCTTTGGTCAATCGGGAAACCCAATTCTATAACGAGCCTAAGTGGTCATACAAGCCCTATCGAATCAGTAGCTTTCGATTC...

CDS

Download CDS FASTA

3036 bp · LXL04_027198|LXL04_027198|OH1004|CDS

ATGAATACTGACCAAATAGGCTTATTGTACAGAGGGATGTCCAGATTCCAGGGAAATACTGGCATTCTTGGTGGCACTGCAAAGGAATTTGTCGCTCATTCGGCAAACGTGAACTGTTTGAAAATCGGGAAGAAGACACATCGAAACTTCATCACAGGTGGCGACGATGAAAAAGTAAATCTTTGGTCAATCGGGAAACCCAATTCTATAACGAGCCTAAGTGGTCATACAAGCCCTATCGAATCAGTAGCTTTCGATTC...

Protein

Download Protein FASTA

1011 aa · LXL04_027198|LXL04_027198|OH1004|PROTEIN

MNTDQIGLLYRGMSRFQGNTGILGGTAKEFVAHSANVNCLKIGKKTHRNFITGGDDEKVNLWSIGKPNSITSLSGHTSPIESVAFDSTDVIVAAGASSGVIKLWDLEETKVVRTLNGHRSYCTAVEFHPFGEFLASGSMDTNLKIWDIRKKGCIHTYKGHRRAVSTIRFSPDGRWVVSGGLDNVVKIWDLTAGKLLHEFKFHEGHIKSMDFHPFEFLLATGSSDKTVKFWDLETFELIGTTKPEANGVRSVTFHPDGRSL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_027198
TK1151 IDTkA07G039860
OH-1004 IDLXL04_027198
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)93.800
Protein coverage (%)TK1151 95.526 / OH-1004 80.415
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_027198
LocationChr06:10896991-10902125 (-)
DescriptionSimilar to At5g23430: Katanin p80 WD40 repeat-containing subunit B1 homolog
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g61210 May participate in a complex which severs microtubules in an ATP-dependent manner (By similarity).
DWA3, an Arabidopsis DWD protein, acts as a negative regulator in ABA signal transduction.2011 · DOI: 10.1016/j.plantsci.2010.10.008
At1g11160 May participate in a complex which severs microtubules in an ATP-dependent manner (By similarity). No verified direct reference in this release
At5g08390 May participate in a complex which severs microtubules in an ATP-dependent manner (By similarity). No verified direct reference in this release
At5g23430 May participate in a complex which severs microtubules in an ATP-dependent manner (By similarity). No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_027198 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0007019 microtubule depolymerization Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0051013 microtubule severing Biological Process
GO:0051510 regulation of unidimensional cell growth Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005874 microtubule Cellular Component
GO:0008352 katanin complex Cellular Component
GO:0015630 microtubule cytoskeleton Cellular Component
GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component
GO:0008017 microtubule binding Molecular Function
KEGG gene cross-reference
ath:AT1G11160
ath:AT1G61210
ath:AT5G08390
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.649
Rank 1 · LXL04_027198 · OH-1004
Nucleus0.215
Rank 2 · LXL04_027198 · OH-1004
Cell membrane0.153
Rank 3 · LXL04_027198 · OH-1004
Golgi apparatus0.087
Rank 4 · LXL04_027198 · OH-1004
Endoplasmic reticulum0.055
Rank 5 · LXL04_027198 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25168.2Beta-prop_WDR36-Utp21_2nd20-154 aa
PF25172.2Beta-prop_WDR3_2nd24-106 aa
PF23381.2Beta-prop_IFT122_1st27-112 aa
PF25391.2WD40_Gbeta27-152 aa
PF25174.2Beta-prop_THOC328-107 aa
PF25175.2Beta-prop_WDR528-156 aa
PF25173.2Beta-prop_WDR3_1st29-158 aa
PF25047.1Beta-prop_TEP1_2nd29-148 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_027198PF25168.2Beta-prop_WDR36-Utp21_2nd201543.7e-32112.6
LXL04_027198PF25172.2Beta-prop_WDR3_2nd241062.5e-29103.1
LXL04_027198PF23381.2Beta-prop_IFT122_1st271122.3e-48165.7
LXL04_027198PF25391.2WD40_Gbeta271523.9e-30105.7
LXL04_027198PF25174.2Beta-prop_THOC3281073.4e-53181.1
LXL04_027198PF25175.2Beta-prop_WDR5281563.7e-51174.8
LXL04_027198PF25173.2Beta-prop_WDR3_1st291585.4e-53180.1
LXL04_027198PF25047.1Beta-prop_TEP1_2nd291485.1e-2072.4
LXL04_027198PF24796.2WDR55321111.9e-2487.0
LXL04_027198PF24782.3WD40_MABP1-WDR62_2nd321901.1e-1558.1
LXL04_027198PF24814.2WD40_Prp19332739.3e-49166.7
LXL04_027198PF24817.2WD40_WDHD1_1st331181.7e-34120.1
LXL04_027198PF23409.2Beta-prop_EML332032.1e-1764.2
LXL04_027198PF29037.1DSE1_N351088.4e-1968.6
LXL04_027198PF23393.3Beta-prop_WDR90_POC16_2nd451494.1e-32112.3
LXL04_027198PF23414.2Beta-prop_EML_2461934.3e-30105.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4HTH8Arabidopsis thalianaKatanin p80 WD40 repeat-containing subunit B1 homolog KTN80.272.857%Swiss-Protweak database homology
A0A1P8AW69Arabidopsis thalianaKatanin p80 WD40 repeat-containing subunit B1 homolog KTN80.167.671%Swiss-Protweak database homology
F4KB17Arabidopsis thalianaKatanin p80 WD40 repeat-containing subunit B1 homolog KTN80.370.707%Swiss-Protweak database homology
Q8H0T9Arabidopsis thalianaKatanin p80 WD40 repeat-containing subunit B1 homolog KTN80.469.966%Swiss-Protweak database homology

JBrowse

View in Genome Browser