LXL04_027152 | RubberDandelionOmics

Gene overview

LXL04_027152

Reference: OH-1004 Chr: Chr06 Coordinates: 9778751-9779860 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1023 bp · LXL04_027152|LXL04_027152|OH1004|cDNA

ATGGCCCAATCGAAGAGTGAACCAGCTAATTCTTCCTCCGGCGAAGAGGAGGAAGCTTCATCTGAAGGATCGGAGTCAGAATCGGAGACCGACAAAACATCAACACCTCCACCTTCTGCCAAGAAAACGCAACTCACCCACCATTCATTGTCCGACGAATCGGACTCAGAGTCTGAATCCGACACCGTCAAGAATCCCAAACCTTTAGCCTCAGTTCCTATGGATGATGATCAGTCGAAAAAGCCTAGATCCAAGAATAC...

CDS

Download CDS FASTA

1023 bp · LXL04_027152|LXL04_027152|OH1004|CDS

ATGGCCCAATCGAAGAGTGAACCAGCTAATTCTTCCTCCGGCGAAGAGGAGGAAGCTTCATCTGAAGGATCGGAGTCAGAATCGGAGACCGACAAAACATCAACACCTCCACCTTCTGCCAAGAAAACGCAACTCACCCACCATTCATTGTCCGACGAATCGGACTCAGAGTCTGAATCCGACACCGTCAAGAATCCCAAACCTTTAGCCTCAGTTCCTATGGATGATGATCAGTCGAAAAAGCCTAGATCCAAGAATAC...

Protein

Download Protein FASTA

340 aa · LXL04_027152|LXL04_027152|OH1004|PROTEIN

MAQSKSEPANSSSGEEEEASSEGSESESETDKTSTPPPSAKKTQLTHHSLSDESDSESESDTVKNPKPLASVPMDDDQSKKPRSKNTTARYSPPPVKPPTGKRPAAEVEAADPKRIKQKTVIASSAPDADNGGEKKQLFQRLWSEENEIELIQGMIDYVNEKGKDPVADVNNFHDFVKKSLHVDVNNKQVIAKVRRLKKKYENNVTRAKNTVMSSTTKKVKINVTPKLNKNRKSNVNGGVELEPEVTLTPTPTLTPTPNE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027152`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027152

Location Chr06:9778751-9779860 (+)

Description Similar to At1g61730: Probable transcription factor At1g61730

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g61730`	Probable transcription factor At1g61730.	No verified direct reference in this release
`At4g00390`	Probable transcription factor At4g00390.	No verified direct reference in this release
`At4g25210`	Transcription factor that binds promoters containing the CryR2 element, 5'-ACATAWCT-3'.	No verified direct reference in this release
`At1g11510`	Probable transcription factor At1g11510.	No verified direct reference in this release
`At2g01370`	Probable transcription factor At2g01370.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027152 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0016592 mediator complex Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G11510

ath:AT1G61730

ath:AT2G01370

ath:AT4G00390

ath:AT4G25210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.982

Rank 1 · LXL04_027152 · OH-1004

Cytoplasm0.059

Rank 2 · LXL04_027152 · OH-1004

Cell membrane0.019

Rank 3 · LXL04_027152 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_027152 · OH-1004

Plastid0.008

Rank 5 · LXL04_027152 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04504.21GeBP-like_DBD139-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027152	`PF04504.21`	GeBP-like_DBD	139	216	3e-25	89.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SYA9`	Arabidopsis thaliana	Probable transcription factor At1g61730	29.254%	Swiss-Prot	weak database homology
`O23063`	Arabidopsis thaliana	Probable transcription factor At4g00390	34.343%	Swiss-Prot	moderate database homology
`Q9SB42`	Arabidopsis thaliana	GLABROUS1 enhancer-binding protein-like	30.213%	Swiss-Prot	moderate database homology
`C0SUU6`	Arabidopsis thaliana	Probable transcription factor At1g11510	28.135%	Swiss-Prot	weak database homology
`Q9ZU30`	Arabidopsis thaliana	Probable transcription factor At2g01370	33.588%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card