LXL04_027150 | RubberDandelionOmics

Gene overview

LXL04_027150

Reference: OH-1004 Chr: Chr06 Coordinates: 9659342-9660141 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

315 bp · LXL04_027150|LXL04_027150|OH1004|cDNA

ATGGCTTTGGTTGGGTCGATAGGAGCCTCTCGAGTTTTGTTGAAGCTTAACTCTGATCTCAGTGGCTCGACCAGTCAAGCCTTTACGACTGGAGCTAGCCATGGCATCGTGACTCGTTCTAAGCTCGTATTCAAGACCCAATCCAAACATGATGAAAAAGAGATCAGTCGTAGAGTTGTGCTTAGACTGATTACTAGTATGCTAGCTTCCGGTTATTTTGTTCAAATTATGCTCGCAAATGCCAAACTGATGAACATGGA...

CDS

Download CDS FASTA

315 bp · LXL04_027150|LXL04_027150|OH1004|CDS

ATGGCTTTGGTTGGGTCGATAGGAGCCTCTCGAGTTTTGTTGAAGCTTAACTCTGATCTCAGTGGCTCGACCAGTCAAGCCTTTACGACTGGAGCTAGCCATGGCATCGTGACTCGTTCTAAGCTCGTATTCAAGACCCAATCCAAACATGATGAAAAAGAGATCAGTCGTAGAGTTGTGCTTAGACTGATTACTAGTATGCTAGCTTCCGGTTATTTTGTTCAAATTATGCTCGCAAATGCCAAACTGATGAACATGGA...

Protein

Download Protein FASTA

104 aa · LXL04_027150|LXL04_027150|OH1004|PROTEIN

MALVGSIGASRVLLKLNSDLSGSTSQAFTTGASHGIVTRSKLVFKTQSKHDEKEISRRVVLRLITSMLASGYFVQIMLANAKLMNMDPPPHPSTRLLTSMALKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027150`
TK1151 ID	TkA07G035540
OH-1004 ID	LXL04_027150
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	91.600
Protein coverage (%)	TK1151 71.552 / OH-1004 79.808 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027150

Location Chr06:9659342-9660141 (+)

Description Similar to PSBQ1: Oxygen-evolving enhancer protein 3-1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21280`	May participate in photosystem II assembly and stabilization.	The PsbQ protein is required in Arabidopsis for photosystem II assembly/stability and photoautotrophy under low light conditions.2006 · DOI: 10.1074/jbc.m603582200

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027150 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009767 photosynthetic electron transport chain Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009654 photosystem II oxygen evolving complex Cellular Component

GO:0019898 extrinsic component of membrane Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G21280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.961

Rank 1 · LXL04_027150 · OH-1004

Mitochondrion0.034

Rank 2 · LXL04_027150 · OH-1004

Nucleus0.029

Rank 3 · LXL04_027150 · OH-1004

Cytoplasm0.014

Rank 4 · LXL04_027150 · OH-1004

Cell membrane0.011

Rank 5 · LXL04_027150 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XFT3`	Arabidopsis thaliana	Oxygen-evolving enhancer protein 3-1, chloroplastic	36.082%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card