LXL04_027149 | RubberDandelionOmics

Gene overview

LXL04_027149

Reference: OH-1004 Chr: Chr06 Coordinates: 9648277-9656098 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2751 bp · LXL04_027149|LXL04_027149|OH1004|cDNA

ATGAGTTCTCGGAATCAAAACAAGCCGCCTGTTCCTCGCAGTCCTGTAAATAAAAATAAAGCAGTTGATGATGCTCCTTTAGATAAACGTAGGAAAATTGGAGCTGGTAGGATGATGGCCTCCACAACAGCAAGTAGAGGCAGGCAAGCACTTGCCCCAATGAACAATCAGAAGGATGTTCCTGTAGCACCACCCTCTGAAACCGAGGTTTCTGAGTGTGAAAATATCGAATTCACAAAGGAGGAGGTCGATGTGTTATT...

CDS

Download CDS FASTA

2751 bp · LXL04_027149|LXL04_027149|OH1004|CDS

ATGAGTTCTCGGAATCAAAACAAGCCGCCTGTTCCTCGCAGTCCTGTAAATAAAAATAAAGCAGTTGATGATGCTCCTTTAGATAAACGTAGGAAAATTGGAGCTGGTAGGATGATGGCCTCCACAACAGCAAGTAGAGGCAGGCAAGCACTTGCCCCAATGAACAATCAGAAGGATGTTCCTGTAGCACCACCCTCTGAAACCGAGGTTTCTGAGTGTGAAAATATCGAATTCACAAAGGAGGAGGTCGATGTGTTATT...

Protein

Download Protein FASTA

916 aa · LXL04_027149|LXL04_027149|OH1004|PROTEIN

MSSRNQNKPPVPRSPVNKNKAVDDAPLDKRRKIGAGRMMASTTASRGRQALAPMNNQKDVPVAPPSETEVSECENIEFTKEEVDVLLNEKFKGKKFDSKGKQDWMIEYIKKLKICIKWFQKGLEDLAEEKNKLHTMLDLSEKKFVEAEAAMKLKEEEFKSTISKLEDNISSLKQSLANEVSQKLDAIDQLNNEKEANTALKKDQDSLKEKLSNSEKDLTTAKDKIKQQEDMYKRLQEYNTSLQQYNSKLQTELKTATDAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027149`
TK1151 ID	TkA07G035530
OH-1004 ID	LXL04_027149
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 84.973 / OH-1004 51.856 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027149

Location Chr06:9648277-9656098 (-)

Description Similar to KIN14C: Kinesin-like protein KIN-14C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g21270`	Kinesin that supports microtubule movement in an ATP- dependent manner and has a minus-end directed polarity.	The Arabidopsis ATK1 gene is required for spindle morphogenesis in male meiosis.2002 · DOI: 10.1242/dev.129.10.2401 Arabidopsis thaliana protein, ATK1, is a minus-end directed kinesin that exhibits non-processive movement.2002 · DOI: 10.1002/cm.10045
`At4g05190`	Kinesin that supports microtubule movement in an ATP- dependent manner and that functions as a minus-end directed motor as well as a plus-end tracking protein.	A minus-end-directed kinesin with plus-end tracking protein activity is involved in spindle morphogenesis.2005 · DOI: 10.1091/mbc.e04-10-0935 The kinesin ATK5 functions in early spindle assembly in Arabidopsis.2007 · DOI: 10.1105/tpc.106.047613
`At5g54670`	Kinesin-like protein KIN-14N.	No verified direct reference in this release
`At4g27180`	Kinesin-like protein KIN-14M.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0105700`	Kinesin-like protein KIN-14N.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027149 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000226 microtubule cytoskeleton organization Biological Process

GO:0007018 microtubule-based movement Biological Process

GO:0009971 anastral spindle assembly involved in male meiosis Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051301 cell division Biological Process

GO:0000776 kinetochore Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005819 spindle Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005872 minus-end kinesin complex Cellular Component

KEGG gene cross-reference

ath:AT4G05190

ath:AT4G21270

ath:AT4G27180

ath:AT5G54670

dosa:Os07g0105700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.695

Rank 1 · LXL04_027149 · OH-1004

Nucleus0.298

Rank 2 · LXL04_027149 · OH-1004

Golgi apparatus0.084

Rank 3 · LXL04_027149 · OH-1004

Cell membrane0.082

Rank 4 · LXL04_027149 · OH-1004

Mitochondrion0.067

Rank 5 · LXL04_027149 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796.12Microtub_bd424-585 aa

PF00225.30Kinesin447-768 aa

PF00085.27Thioredoxin806-905 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027149	`PF16796.12`	Microtub_bd	424	585	5.2e-53	179.8
LXL04_027149	`PF00225.30`	Kinesin	447	768	1.1e-109	367.2
LXL04_027149	`PF00085.27`	Thioredoxin	806	905	4.1e-18	66.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q07970`	Arabidopsis thaliana	Kinesin-like protein KIN-14C	59.158%	Swiss-Prot	strong database homology
`F4JGP4`	Arabidopsis thaliana	Kinesin-like protein KIN-14D	58.437%	Swiss-Prot	strong database homology
`P46875`	Arabidopsis thaliana	Kinesin-like protein KIN-14N	54.700%	Swiss-Prot	strong database homology
`P46864`	Arabidopsis thaliana	Kinesin-like protein KIN-14M	53.235%	Swiss-Prot	strong database homology
`A3BFT0`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-14N	58.368%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card