LXL04_027111 | RubberDandelionOmics

Gene overview

LXL04_027111

Reference: OH-1004 Chr: Chr06 Coordinates: 9122224-9124440 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1131 bp · LXL04_027111|LXL04_027111|OH1004|cDNA

ATGCAAGTACAAAGAAACAACTACATTTACGATTATTCAATGTCTCCAAGCTTCAACGATGAGAACTCACTCTTCAACTTCGTGGTAAAAGACGGCAATGGGGTCAAAGGTCTTGTTGACTCCGGCCTCACAGAGGTCCCCGGCCGCTACATCCAACCACCCAACCAGCGAATCAACAAGCAACAAGCAGCCGCCACATCGCCGGAAAACATGACCATTGATTTATCAGAGCTCGATGGACCTAACCATGATCAGGTGGT...

CDS

Download CDS FASTA

1131 bp · LXL04_027111|LXL04_027111|OH1004|CDS

ATGCAAGTACAAAGAAACAACTACATTTACGATTATTCAATGTCTCCAAGCTTCAACGATGAGAACTCACTCTTCAACTTCGTGGTAAAAGACGGCAATGGGGTCAAAGGTCTTGTTGACTCCGGCCTCACAGAGGTCCCCGGCCGCTACATCCAACCACCCAACCAGCGAATCAACAAGCAACAAGCAGCCGCCACATCGCCGGAAAACATGACCATTGATTTATCAGAGCTCGATGGACCTAACCATGATCAGGTGGT...

Protein

Download Protein FASTA

376 aa · LXL04_027111|LXL04_027111|OH1004|PROTEIN

MQVQRNNYIYDYSMSPSFNDENSLFNFVVKDGNGVKGLVDSGLTEVPGRYIQPPNQRINKQQAAATSPENMTIDLSELDGPNHDQVVKAIAHAAETLGFFQVVNHGVPLELLDSLKVAAHQFFNQPPEKKAVYLKGVSPSPVVKYGTSFVPEIEKALEWKDYVSMIYTNDEEALKFWPNECKEVALNYIKTSMEMVKRLLQALIENLGVKVEESILDTLLGFKMVNMNFYPTCPNPELTVGVGRHSDMGTLTVLLQDGIG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027111`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027111

Location Chr06:9122224-9124440 (-)

Description Similar to S8H: Scopoletin 8-hydroxylase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g12900`	Involved in the pathway of sideretin biosynthesis from feruloyl CoA, a redox-active catecholic metabolite exuded by roots in response to iron deficiency in order to facilitate the uptake of iron; this pathway consists in the successive conversion from feruloyl CoA to scopoletin, from scopoletin to fraxetin and from fraxetin to sideretin.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027111 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0009620 response to fungus Biological Process

GO:0009699 phenylpropanoid biosynthetic process Biological Process

GO:0009805 coumarin biosynthetic process Biological Process

GO:0010039 response to iron ion Biological Process

GO:0010447 response to acidic pH Biological Process

GO:0106147 fraxetin biosynthesis Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016706 2-oxoglutarate-dependent dioxygenase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051213 dioxygenase activity Molecular Function

GO:0102312 4-coumaroyl 2'-hydroxylase activity Molecular Function

KEGG gene cross-reference

ath:AT3G12900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.812

Rank 1 · LXL04_027111 · OH-1004

Nucleus0.339

Rank 2 · LXL04_027111 · OH-1004

Peroxisome0.053

Rank 3 · LXL04_027111 · OH-1004

Mitochondrion0.049

Rank 4 · LXL04_027111 · OH-1004

Endoplasmic reticulum0.048

Rank 5 · LXL04_027111 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14226.13DIOX_N72-179 aa

PF03171.272OG-FeII_Oxy224-326 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027111	`PF14226.13`	DIOX_N	72	179	2.1e-23	83.9
LXL04_027111	`PF03171.27`	2OG-FeII_Oxy	224	326	4e-29	101.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LE86`	Arabidopsis thaliana	Scopoletin 8-hydroxylase	67.036%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card