LXL04_027063 | RubberDandelionOmics

Gene overview

LXL04_027063

Reference: OH-1004 Chr: Chr06 Coordinates: 8074079-8075856 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

833 bp · LXL04_027063|LXL04_027063|OH1004|cDNA

ATGAAAAGGGATAAAAAGAGTTGCCATTGTTCATGGACGCCATGGGAGATTCTTGTGGAGGTTTTTCTAGGGTTGCTCACCGGAGGATGGGTGGTTACTTGCCGCAAAATATCTTAAGGAAGGCCACTGTTCGGTCTTACAACAGGTCTAGGGTTCCTCGACTTAGATGGACAGATGAACTTCATCAATTTTTTGTGAATGCAGTTATAAGACTTGGCGGCGAAGATAGGGCAACTCCAAAGATGATATTGCAGATGATG...

CDS

Download CDS FASTA

813 bp · LXL04_027063|LXL04_027063|OH1004|CDS

TTGCCATTGTTCATGGACGCCATGGGAGATTCTTGTGGAGGTTTTTCTAGGGTTGCTCACCGGAGGATGGGTGGTTACTTGCCGCAAAATATCTTAAGGAAGGCCACTGTTCGGTCTTACAACAGGTCTAGGGTTCCTCGACTTAGATGGACAGATGAACTTCATCAATTTTTTGTGAATGCAGTTATAAGACTTGGCGGCGAAGATAGGGCAACTCCAAAGATGATATTGCAGATGATGAATGTGAAGGGAATATCTGT...

Protein

Download Protein FASTA

270 aa · LXL04_027063|LXL04_027063|OH1004|PROTEIN

MPLFMDAMGDSCGGFSRVAHRRMGGYLPQNILRKATVRSYNRSRVPRLRWTDELHQFFVNAVIRLGGEDRATPKMILQMMNVKGISVSHIKSHLQMYRSMKNEVVLQGQRLTYILMLPFFTSNMIDTRKTKEMESYNSHLCLLHQNNNYHGVSINIGHEPLEQNYNQSNLQQLVHTLKNKFHQGNLTNYYEKQDGEKTEDNSQVFEASNAYLRKNVIYIDFLANNFTSNHNESNDVENIEEDIVATSYSVTNVDTELTLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027063`
TK1151 ID	TkA07G029420
OH-1004 ID	LXL04_027063
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.300
Protein coverage (%)	TK1151 96.787 / OH-1004 95.926 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027063

Location Chr06:8074079-8075856 (-)

Description Similar to At1g14600: Putative Myb family transcription factor At1g14600

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g14600`	Putative transcription factor.	No verified direct reference in this release
`At5g42630`	Probable transcription factor that regulates carpel integuments formation.	ABERRANT TESTA SHAPE encodes a KANADI family member, linking polarity determination to separation and growth of Arabidopsis ovule integuments.2006 · DOI: 10.1111/j.1365-313x.2006.02717.x A new dominant Arabidopsis transparent testa mutant, sk21-D, and modulation of seed flavonoid biosynthesis by KAN4.2010 · DOI: 10.1111/j.1467-7652.2010.00525.x
`At4g17695`	Probable transcription factor that regulates lateral organ polarity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0670300`	Probable transcription factor involved in the regulation of plant height by elongating internode cell length.	OsMPH1 regulates plant height and improves grain yield in rice.2017 · DOI: 10.1371/journal.pone.0180825 OsMYB45 plays an important role in rice resistance to cadmium stress.2017 · DOI: 10.1016/j.plantsci.2017.08.002
`Os04g0566600`	Transcriptional repressor that plays a role in the regulation of organ identity and spikelet meristem determinacy.	MORE FLORET1 Encodes a MYB Transcription Factor That Regulates Spikelet Development in Rice.2020 · DOI: 10.1104/pp.20.00658

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027063 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010158 abaxial cell fate specification Biological Process

GO:0010582 floral meristem determinacy Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0030154 cell differentiation Biological Process

GO:0048481 plant ovule development Biological Process

GO:0080060 integument development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

KEGG gene cross-reference

ath:AT1G14600

ath:AT4G17695

ath:AT5G42630

dosa:Os04g0566600

dosa:Os06g0670300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · LXL04_027063 · OH-1004

Cytoplasm0.114

Rank 2 · LXL04_027063 · OH-1004

Cell membrane0.024

Rank 3 · LXL04_027063 · OH-1004

Endoplasmic reticulum0.014

Rank 4 · LXL04_027063 · OH-1004

Plastid0.011

Rank 5 · LXL04_027063 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding47-98 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027063	`PF00249.38`	Myb_DNA-binding	47	98	2e-07	31.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q700D9`	Arabidopsis thaliana	Putative Myb family transcription factor At1g14600	58.904%	Swiss-Prot	weak database homology
`Q9FJV5`	Arabidopsis thaliana	Probable transcription factor KAN4	46.809%	Swiss-Prot	weak database homology
`Q941I2`	Arabidopsis thaliana	Probable transcription factor KAN3	46.988%	Swiss-Prot	weak database homology
`A0A0P0X0C0`	Oryza sativa subsp. japonica	Myb family transcription factor MPH1	63.636%	Swiss-Prot	weak database homology
`A3AWH5`	Oryza sativa subsp. japonica	Myb family transcription factor MOF1	68.254%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card