LXL04_027047 | RubberDandelionOmics

Gene overview

LXL04_027047

Reference: OH-1004 Chr: Chr06 Coordinates: 7715282-7716115 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · LXL04_027047|LXL04_027047|OH1004|cDNA

ATGAATAACCTAAACAAAATCTTGATAACCCTGGTCATTCTCTTGGCTTTAGTAATTACACTTTCCGCCTCACTCATAGAAGACGATGACAAAGATGCTATTCCTACTTATGGTTCTCTAAGAGGGGCGAGTCGATTCCTTGCCCAACAACCGAGGGACTCGCTTAAATGCaacaagaacccaagaatttgTCGGGCGAAAGGAAGCCAAGGCCCAGATTGTTGCAAGAAGAAATGTGTCAATGTTAAGACTGACAAACA...

CDS

Download CDS FASTA

420 bp · LXL04_027047|LXL04_027047|OH1004|CDS

ATGAATAACCTAAACAAAATCTTGATAACCCTGGTCATTCTCTTGGCTTTAGTAATTACACTTTCCGCCTCACTCATAGAAGACGATGACAAAGATGCTATTCCTACTTATGGTTCTCTAAGAGGGGCGAGTCGATTCCTTGCCCAACAACCGAGGGACTCGCTTAAATGCAACAAGAACCCAAGAATTTGTCGGGCGAAAGGAAGCCAAGGCCCAGATTGTTGCAAGAAGAAATGTGTCAATGTTAAGACTGACAAACA...

Protein

Download Protein FASTA

139 aa · LXL04_027047|LXL04_027047|OH1004|PROTEIN

MNNLNKILITLVILLALVITLSASLIEDDDKDAIPTYGSLRGASRFLAQQPRDSLKCNKNPRICRAKGSQGPDCCKKKCVNVKTDKQNCGLCGKKCKNQEICCNGKCVNLMADKQTEHWRYKDKADFEVPVILNNPNVD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_027047`
TK1151 ID	TkA07G027910
OH-1004 ID	LXL04_027047
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 48.795 / OH-1004 58.273 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_027047

Location Chr06:7715282-7716115 (+)

Description Similar to At1g50720: Stigma-specific STIG1-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50720`	Stigma-specific STIG1-like protein 3.	No verified direct reference in this release
`At4g26880`	Stigma-specific STIG1-like protein 1.	No verified direct reference in this release
`At5g55110`	Stigma-specific STIG1-like protein 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027047 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G50720

ath:AT4G26880

ath:AT5G55110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.902

Rank 1 · LXL04_027047 · OH-1004

Cytoplasm0.041

Rank 2 · LXL04_027047 · OH-1004

Endoplasmic reticulum0.036

Rank 3 · LXL04_027047 · OH-1004

Cell membrane0.027

Rank 4 · LXL04_027047 · OH-1004

Lysosome / Vacuole0.017

Rank 5 · LXL04_027047 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04885.20Stig156-115 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_027047	`PF04885.20`	Stig1	56	115	2.6e-18	67.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6T5`	Arabidopsis thaliana	Stigma-specific STIG1-like protein 3	30.534%	Swiss-Prot	moderate database homology
`Q9SZ28`	Arabidopsis thaliana	Stigma-specific STIG1-like protein 1	38.462%	Swiss-Prot	moderate database homology
`Q9FLQ0`	Arabidopsis thaliana	Stigma-specific STIG1-like protein 2	31.429%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card