Gene Card
Gene overview
cDNA / CDS / Protein Sequences
825 bp · LXL04_027044|LXL04_027044|OH1004|cDNA
ATGTCCATGGCAGACGTTGGTGCTGGAGGTGAAGAAGTTGTTGTTACATTTGAACGCATTGAAATTCTTACTCGAAGGTTAACTCTTCATATCTCAAATTTCTTAAACTATCATTTTCTAACCAAAATCAAACTTTCAAGGGTCAGTACAATGTTGAACTTCAGTTCTGCTACTTACAGCTTCAAGGACAAATTAGAACCATCATATAAGGGACTAATTCATGAAATGTTCACAATGGTTTTAAGAGGCTTATCTACCAC...
825 bp · LXL04_027044|LXL04_027044|OH1004|CDS
ATGTCCATGGCAGACGTTGGTGCTGGAGGTGAAGAAGTTGTTGTTACATTTGAACGCATTGAAATTCTTACTCGAAGGTTAACTCTTCATATCTCAAATTTCTTAAACTATCATTTTCTAACCAAAATCAAACTTTCAAGGGTCAGTACAATGTTGAACTTCAGTTCTGCTACTTACAGCTTCAAGGACAAATTAGAACCATCATATAAGGGACTAATTCATGAAATGTTCACAATGGTTTTAAGAGGCTTATCTACCAC...
Protein
Download Protein FASTA274 aa · LXL04_027044|LXL04_027044|OH1004|PROTEIN
MSMADVGAGGEEVVVTFERIEILTRRLTLHISNFLNYHFLTKIKLSRVSTMLNFSSATYSFKDKLEPSYKGLIHEMFTMVLRGLSTTKLTRLEKFRSCQDGYIVKSSLKVEDGIVHWRNHLRFPEDAMLSPEAKDLIYRLLCDVEHRLGTSGPDQIKSHPWFKDVMWDQLYEMEAAFKPEVNGELDTQNFMKFDELNPPTSGRTSSGPSRKQLNPKDLNFVGYTYKNFDAVKAMRDNPDLMRSASSGLSNNSHLGNRGSS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_027044 |
|---|---|
| TK1151 ID | TkA07G027610 |
| OH-1004 ID | LXL04_027044 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_027044 |
|---|---|
| Location | Chr06:7639079-7641839 (+) |
| Description | Similar to SSRP1: FACT complex subunit SSRP1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000902 cell morphogenesis Biological Process GO:0000920 septum digestion after cytokinesis Biological Process GO:0006260 DNA replication Biological Process GO:0006281 DNA repair Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0007118 budding cell apical bud growth Biological Process GO:0007163 establishment or maintenance of cell polarity Biological Process GO:0009267 cellular response to starvation Biological Process GO:0030447 filamentous growth Biological Process GO:0030866 cortical actin cytoskeleton organization Biological Process GO:0030950 establishment or maintenance of actin cytoskeleton polarity Biological Process |
| KEGG gene cross-reference | cal:CAALFM_C110380CA ddi:DDB_G0288753 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00433.30Pkinase_C181-225 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_027044 | PF00433.30 | Pkinase_C | 181 | 225 | 3.6e-08 | 34.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.