LXL04_026933 | RubberDandelionOmics

Gene overview

LXL04_026933

Reference: OH-1004 Chr: Chr06 Coordinates: 5531558-5538989 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1863 bp · LXL04_026933|LXL04_026933|OH1004|cDNA

ATGGCAGCCACACCTGGACTTCTCACAGACTGGCCATGGAAACCACTTGGAAGCTTTAAGTACGTGTTATTGCTCCCGTGGGTGGTGAAGAGCAGTTATGAATTCGTGACCGCTGATAAGAAAGACATAATGTCGGCCTTAATTTTTCCGTTTCTTTTAACAAGAATGATTGGTAATCAGATCTGGATTTCTTTGAACCGCTACATAACCGCGAAAGGCAAAAACCGGATCGTTAACAAGACTATTGAATTCGAGCAAGT...

CDS

Download CDS FASTA

1863 bp · LXL04_026933|LXL04_026933|OH1004|CDS

ATGGCAGCCACACCTGGACTTCTCACAGACTGGCCATGGAAACCACTTGGAAGCTTTAAGTACGTGTTATTGCTCCCGTGGGTGGTGAAGAGCAGTTATGAATTCGTGACCGCTGATAAGAAAGACATAATGTCGGCCTTAATTTTTCCGTTTCTTTTAACAAGAATGATTGGTAATCAGATCTGGATTTCTTTGAACCGCTACATAACCGCGAAAGGCAAAAACCGGATCGTTAACAAGACTATTGAATTCGAGCAAGT...

Protein

Download Protein FASTA

620 aa · LXL04_026933|LXL04_026933|OH1004|PROTEIN

MAATPGLLTDWPWKPLGSFKYVLLLPWVVKSSYEFVTADKKDIMSALIFPFLLTRMIGNQIWISLNRYITAKGKNRIVNKTIEFEQVDRERDWDDQIIFNGLLYYFGNYYFEGAKYIPWWRSDGVIIVILLHAMVVEFLYYWLHRALHHHFLYNRYHSHHHSSIVTEPITSVIHPFAEHIAYFALFAIPLMTTVLSGTASIATFSGYISYVDIMNNMGHCNFEFIPKSLFNIFPPLKYIIYTPSYHSLHHTQFRTNYSLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026933`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026933

Location Chr06:5531558-5538989 (+)

Description Similar to GL1-5: Very-long-chain aldehyde decarbonylase GL1-5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02205`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	Overexpression of Arabidopsis ECERIFERUM1 promotes wax very-long-chain alkane biosynthesis and influences plant response to biotic and abiotic stresses.2011 · DOI: 10.1104/pp.111.172320 Reconstitution of plant alkane biosynthesis in yeast demonstrates that Arabidopsis ECERIFERUM1 and ECERIFERUM3 are core components of a very-long-chain alkane synthesis complex.2012 · DOI: 10.1105/tpc.112.099796 Molecular characterization of the CER1 gene of arabidopsis involved in epicuticular wax biosynthesis and pollen fertility.1995 · DOI: 10.1105/tpc.7.12.2115

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BHF1`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release
`Os10g0471100`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	Wax-deficient anther1 is involved in cuticle and wax production in rice anther walls and is required for pollen development.2006 · DOI: 10.1105/tpc.106.042044
`UniProt: B8AFI3`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release
`Os02g0621300`	Aldehyde decarbonylase involved in the conversion of aldehydes to alkanes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026933 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008610 lipid biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009611 response to wounding Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0010584 pollen exine formation Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0043447 alkane biosynthetic process Biological Process

KEGG gene cross-reference

ath:AT1G02205

dosa:Os02g0621300

dosa:Os10g0471100

osa:4330012

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.635

Rank 1 · LXL04_026933 · OH-1004

Mitochondrion0.114

Rank 2 · LXL04_026933 · OH-1004

Cytoplasm0.089

Rank 3 · LXL04_026933 · OH-1004

Nucleus0.088

Rank 4 · LXL04_026933 · OH-1004

Golgi apparatus0.049

Rank 5 · LXL04_026933 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04116.20FA_hydroxylase130-270 aa

PF12076.14CER1-like_C450-614 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026933	`PF04116.20`	FA_hydroxylase	130	270	1.7e-22	81.0
LXL04_026933	`PF12076.14`	CER1-like_C	450	614	2.8e-69	232.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HVY0`	Arabidopsis thaliana	Very-long-chain aldehyde decarbonylase CER1	61.316%	Swiss-Prot	strong database homology
`B8BHF1`	Oryza sativa subsp. indica	Very-long-chain aldehyde decarbonylase GL1-5	58.427%	Swiss-Prot	strong database homology
`Q7XDI3`	Oryza sativa subsp. japonica	Very-long-chain aldehyde decarbonylase GL1-5	58.266%	Swiss-Prot	strong database homology
`B8AFI3`	Oryza sativa subsp. indica	Very-long-chain aldehyde decarbonylase GL1-4	57.166%	Swiss-Prot	strong database homology
`Q6K9F6`	Oryza sativa subsp. japonica	Very-long-chain aldehyde decarbonylase GL1-4	56.844%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card