LXL04_026905 | RubberDandelionOmics

Gene overview

LXL04_026905

Reference: OH-1004 Chr: Chr06 Coordinates: 5021861-5025740 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2070 bp · LXL04_026905|LXL04_026905|OH1004|cDNA

ATGGCTGGAGATCCCGACATTCTCACGGACTACATTACCCCACCAGGTGTCACACTCCCACTGGACGGAAACTTCTTCACCTTCACCGGAATGCGAGCACTAGTTGGCACACCATTTCCTTCAGCTTTCAAGGTTCTAAAAGCAACATTGGCGGAGTTCCCAGCTCTTAACGGTCAAAGCGTTTCGTACGCTGTACTCCAGTTCCCTAATGGCGCCGTTAACCCACCCCACACACATCCACGCGCTTCAGAGTTGTTGTT...

CDS

Download CDS FASTA

2070 bp · LXL04_026905|LXL04_026905|OH1004|CDS

ATGGCTGGAGATCCCGACATTCTCACGGACTACATTACCCCACCAGGTGTCACACTCCCACTGGACGGAAACTTCTTCACCTTCACCGGAATGCGAGCACTAGTTGGCACACCATTTCCTTCAGCTTTCAAGGTTCTAAAAGCAACATTGGCGGAGTTCCCAGCTCTTAACGGTCAAAGCGTTTCGTACGCTGTACTCCAGTTCCCTAATGGCGCCGTTAACCCACCCCACACACATCCACGCGCTTCAGAGTTGTTGTT...

Protein

Download Protein FASTA

689 aa · LXL04_026905|LXL04_026905|OH1004|PROTEIN

MAGDPDILTDYITPPGVTLPLDGNFFTFTGMRALVGTPFPSAFKVLKATLAEFPALNGQSVSYAVLQFPNGAVNPPHTHPRASELLFVLMGSLEVGFVDTTNRLFTQTLQQGDIFVFPKGLVHFQFNSDAKNPALGLSAFGSASAGTVSVPNTVFNTSIDDQILAMSFKTDVATIQKIKSGFLGYHSWYGVMAPAEEDWTKVRRRKKSPVWDRNLNATSFFVTGSAESSKKRDLFRSFEVFGEVVDVFMGTRKDRAGRNF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026905`
TK1151 ID	TkA07G016710
OH-1004 ID	LXL04_026905
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	81.800
Protein coverage (%)	TK1151 59.922 / OH-1004 26.270 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026905

Location Chr06:5021861-5025740 (+)

Description Similar to Os09g0568700: Germin-like protein 9-3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g62020`	May play a role in plant defense.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0568700`	May play a role in plant defense.	No verified direct reference in this release
`Os09g0568600`	May play a role in plant defense.	No verified direct reference in this release
`Os09g0568500`	May play a role in plant defense.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026905 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0048046 apoplast Cellular Component

GO:0004784 superoxide dismutase activity Molecular Function

GO:0030145 manganese ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G62020

dosa:Os09g0568500

dosa:Os09g0568700

osa:107277596

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.521

Rank 1 · LXL04_026905 · OH-1004

Nucleus0.387

Rank 2 · LXL04_026905 · OH-1004

Cell membrane0.112

Rank 3 · LXL04_026905 · OH-1004

Endoplasmic reticulum0.088

Rank 4 · LXL04_026905 · OH-1004

Plastid0.044

Rank 5 · LXL04_026905 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00190.29Cupin_144-175 aa

PF07883.18Cupin_266-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026905	`PF00190.29`	Cupin_1	44	175	1.5e-32	113.0
LXL04_026905	`PF07883.18`	Cupin_2	66	134	1.9e-09	37.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M263`	Arabidopsis thaliana	Germin-like protein subfamily 2 member 4	40.404%	Swiss-Prot	weak database homology
`Q652P9`	Oryza sativa subsp. japonica	Germin-like protein 9-3	64.894%	Swiss-Prot	weak database homology
`Q652Q0`	Oryza sativa subsp. japonica	Putative germin-like protein 9-2	64.674%	Swiss-Prot	weak database homology
`Q652Q1`	Oryza sativa subsp. japonica	Germin-like protein 9-1	54.645%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card