LXL04_026881 | RubberDandelionOmics

Gene overview

LXL04_026881

Reference: OH-1004 Chr: Chr06 Coordinates: 4577108-4578852 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

870 bp · LXL04_026881|LXL04_026881|OH1004|cDNA

ATGTGGATCGAACTTGAAGAACACTTCTCTGAAAGCAATGGACCTCTAATATACCAGCTTCAAAGACAAATTACTTCTATTCATCAAGGTGATTCCTCTGTTTCAAAATACTACACTAAACTCAAACAACTATGGGATCAATTGAATTGTCTTATACAATTACCTATGTGTAATTGTGGATCTGCTAAGGCGATGTCTGATTATGCTTCTTCTACTCGCCTTATGCAATTTCTCATGGGGTTAAATGATACATATGAGAG...

CDS

Download CDS FASTA

870 bp · LXL04_026881|LXL04_026881|OH1004|CDS

ATGTGGATCGAACTTGAAGAACACTTCTCTGAAAGCAATGGACCTCTAATATACCAGCTTCAAAGACAAATTACTTCTATTCATCAAGGTGATTCCTCTGTTTCAAAATACTACACTAAACTCAAACAACTATGGGATCAATTGAATTGTCTTATACAATTACCTATGTGTAATTGTGGATCTGCTAAGGCGATGTCTGATTATGCTTCTTCTACTCGCCTTATGCAATTTCTCATGGGGTTAAATGATACATATGAGAG...

Protein

Download Protein FASTA

289 aa · LXL04_026881|LXL04_026881|OH1004|PROTEIN

MWIELEEHFSESNGPLIYQLQRQITSIHQGDSSVSKYYTKLKQLWDQLNCLIQLPMCNCGSAKAMSDYASSTRLMQFLMGLNDTYESLRNQVLVLDPLPSVHKAYSMALSVEKQKGVQINFSTPPESAMFPKNGVNTRATYTLKDDGTVHVLNDTWSEGKRGFIEGTTYKADPKSDEAKLKVKFYVPPFLPIIPVTGDYWILHLDDEYQYALIGQPCRSYLWLNGYSDWYKDLKDKKKGNMNSAHMAQDNNPLFDNNEPS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026881`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026881

Location Chr06:4577108-4578852 (+)

Description Similar to TIL: Temperature-induced lipocalin-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58070`	Involved in basal (BT) and acquired thermotolerance (AT), probably by preventing plasma membrane lipids peroxidation induced by severe heat-shock (HS).	Temperature-induced lipocalin is required for basal and acquired thermotolerance in Arabidopsis.2009 · DOI: 10.1111/j.1365-3040.2009.01972.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026881 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006883 intracellular sodium ion homeostasis Biological Process

GO:0006950 response to stress Biological Process

GO:0006974 DNA damage response Biological Process

GO:0009408 response to heat Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0010286 heat acclimation Biological Process

GO:0010431 seed maturation Biological Process

KEGG gene cross-reference

ath:AT5G58070

ece:Z5756

ecj:JW4110

eco:b4149

ecoc:C3026_22430

ecs:ECs_5130

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.680

Rank 1 · LXL04_026881 · OH-1004

Nucleus0.389

Rank 2 · LXL04_026881 · OH-1004

Endoplasmic reticulum0.053

Rank 3 · LXL04_026881 · OH-1004

Mitochondrion0.052

Rank 4 · LXL04_026881 · OH-1004

Cell membrane0.042

Rank 5 · LXL04_026881 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08212.19Lipocalin_2129-223 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026881	`PF08212.19`	Lipocalin_2	129	223	2.9e-25	89.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FGT8`	Arabidopsis thaliana	Temperature-induced lipocalin-1	71.552%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card