LXL04_026806 | RubberDandelionOmics

Gene overview

LXL04_026806

Reference: OH-1004 Chr: Chr06 Coordinates: 3163906-3167804 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1353 bp · LXL04_026806|LXL04_026806|OH1004|cDNA

ATGGGACAACAATCGTTGATCTATAGTTTTGTATCCAGGGGGACCGTGATTCTCGCAGAGTACACAGAGTTCACCGGAAATTTCACCTCTATTGCTTCCCAGTGCCTCCAGAAGCTTCCCGCAACCAACAATAAATTCACATACAACTGCGATGGACACACCTTTAATTACCTCGTCGAAGATGGTTTCACATACTGTGTTGTGGCTGCCGAATCTGCTGGCCGACAAGTTCCCATGGCTTTCCTAGAGCGAACCAAGGA...

CDS

Download CDS FASTA

1353 bp · LXL04_026806|LXL04_026806|OH1004|CDS

ATGGGACAACAATCGTTGATCTATAGTTTTGTATCCAGGGGGACCGTGATTCTCGCAGAGTACACAGAGTTCACCGGAAATTTCACCTCTATTGCTTCCCAGTGCCTCCAGAAGCTTCCCGCAACCAACAATAAATTCACATACAACTGCGATGGACACACCTTTAATTACCTCGTCGAAGATGGTTTCACATACTGTGTTGTGGCTGCCGAATCTGCTGGCCGACAAGTTCCCATGGCTTTCCTAGAGCGAACCAAGGA...

Protein

Download Protein FASTA

450 aa · LXL04_026806|LXL04_026806|OH1004|PROTEIN

MGQQSLIYSFVSRGTVILAEYTEFTGNFTSIASQCLQKLPATNNKFTYNCDGHTFNYLVEDGFTYCVVAAESAGRQVPMAFLERTKDDFNKKYSGGKAATAAANSLNKEFGPKLKEQMQYCVDHPEEISKLSKVKAQVSEVKGVMMENIEKVLDRGEKIELLVDKTENLRSQAQDFRTQGTQIRRKMWLQNMKIKLIVLGIIIALILIIVLSVCGGFNCGKRLLWARFVELVTRWNGEVIILGGFNEVRFISERLGSVFS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026806`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026806

Location Chr06:3163906-3167804 (+)

Description Similar to VAMP726: Putative vesicle-associated membrane protein 726

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04760`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At2g33120`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At1g04750`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At2g32670`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release
`At4g15780`	Involved in the targeting and/or fusion of transport vesicles to their target membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026806 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000045 autophagosome assembly Biological Process

GO:0009920 cell plate formation involved in plant-type cell wall biogenesis Biological Process

GO:0015031 protein transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0034976 response to endoplasmic reticulum stress Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009504 cell plate Cellular Component

KEGG gene cross-reference

ath:AT1G04750

ath:AT1G04760

ath:AT2G32670

ath:AT2G33120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.615

Rank 1 · LXL04_026806 · OH-1004

Nucleus0.211

Rank 2 · LXL04_026806 · OH-1004

Cell membrane0.172

Rank 3 · LXL04_026806 · OH-1004

Golgi apparatus0.132

Rank 4 · LXL04_026806 · OH-1004

Lysosome / Vacuole0.126

Rank 5 · LXL04_026806 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13774.14Longin18-113 aa

PF00957.28Synaptobrevin130-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026806	`PF13774.14`	Longin	18	113	4.9e-26	91.5
LXL04_026806	`PF00957.28`	Synaptobrevin	130	210	4.7e-30	104.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MAS5`	Arabidopsis thaliana	Putative vesicle-associated membrane protein 726	84.932%	Swiss-Prot	weak database homology
`P47192`	Arabidopsis thaliana	Vesicle-associated membrane protein 722	87.330%	Swiss-Prot	weak database homology
`Q9ZTW3`	Arabidopsis thaliana	Vesicle-associated membrane protein 721	87.215%	Swiss-Prot	weak database homology
`O48850`	Arabidopsis thaliana	Vesicle-associated membrane protein 725	85.845%	Swiss-Prot	weak database homology
`O23429`	Arabidopsis thaliana	Vesicle-associated membrane protein 724	70.909%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card