LXL04_026775 | RubberDandelionOmics

Gene overview

LXL04_026775

Reference: OH-1004 Chr: Chr06 Coordinates: 2757414-2758284 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

792 bp · LXL04_026775|LXL04_026775|OH1004|cDNA

ATGGCCGGAAATACGACCACCACCCCTTTTCTTCAAGATACGGAGGCGGCGACGGCAGAGAAGAACAGCGGCGGAGGTAGGCGGCCAAAACAGCCATGGAAAGGCGATCTTGTGAAAAGCATAGTCTACTCCGGTCTCGACGCTATTATCACTTCATTTTCCCTCATTTCTTCCATCTCCGCCGGCCGTTTATCTTCCGTTGATGTGTTGGTTTTGGGGTTCGCAAACTTGGTGGCGGATGGGATATCAATGGGGATGGG...

CDS

Download CDS FASTA

792 bp · LXL04_026775|LXL04_026775|OH1004|CDS

ATGGCCGGAAATACGACCACCACCCCTTTTCTTCAAGATACGGAGGCGGCGACGGCAGAGAAGAACAGCGGCGGAGGTAGGCGGCCAAAACAGCCATGGAAAGGCGATCTTGTGAAAAGCATAGTCTACTCCGGTCTCGACGCTATTATCACTTCATTTTCCCTCATTTCTTCCATCTCCGCCGGCCGTTTATCTTCCGTTGATGTGTTGGTTTTGGGGTTCGCAAACTTGGTGGCGGATGGGATATCAATGGGGATGGG...

Protein

Download Protein FASTA

263 aa · LXL04_026775|LXL04_026775|OH1004|PROTEIN

MAGNTTTTPFLQDTEAATAEKNSGGGRRPKQPWKGDLVKSIVYSGLDAIITSFSLISSISAGRLSSVDVLVLGFANLVADGISMGMGDYVSSNTEHDVAAKERLVTEWDVANRRRCQEQSLINRYQALGMTHEDATTVVNIFAKYGDVMVEEKMIQNGILSPEEAEKPWKSGLVTFGAFLLFGSAPILSFIVLIPFTQNDTVKFIGACVMSALALAALGIAKAKIAGQNYVVSAGGTLFNGAIAGFAAYVIGWGLRNVAG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026775`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026775

Location Chr06:2757414-2758284 (+)

Description Similar to VIT1: Vacuolar iron transporter 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g01770`	Vacuolar iron transporter involved in the transfer of iron ions from the cytosol to the vacuole for intracellular iron storage.	Localization of iron in Arabidopsis seed requires the vacuolar membrane transporter VIT1.2006 · DOI: 10.1126/science.1132563 Identification of the endodermal vacuole as the iron storage compartment in the Arabidopsis embryo.2009 · DOI: 10.1104/pp.109.144444 Bypassing Iron Storage in Endodermal Vacuoles Rescues the Iron Mobilization Defect in the natural resistance associated-macrophage protein3natural resistance associated-macrophage protein4 Double Mutant.2015 · DOI: 10.1104/pp.15.00380

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026775 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006826 iron ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0060586 multicellular organismal-level iron ion homeostasis Biological Process

GO:0005774 vacuolar membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

GO:0005381 iron ion transmembrane transporter activity Molecular Function

GO:0005384 manganese ion transmembrane transporter activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G01770

pfa:PF3D7_1223700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.481

Rank 1 · LXL04_026775 · OH-1004

Lysosome / Vacuole0.279

Rank 2 · LXL04_026775 · OH-1004

Endoplasmic reticulum0.160

Rank 3 · LXL04_026775 · OH-1004

Cytoplasm0.131

Rank 4 · LXL04_026775 · OH-1004

Golgi apparatus0.094

Rank 5 · LXL04_026775 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01988.25VIT138-252 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026775	`PF01988.25`	VIT1	38	252	4.2e-50	171.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUA5`	Arabidopsis thaliana	Vacuolar iron transporter 1	26.941%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card