RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_026711
Reference: OH-1004 Chr: Chr06 Coordinates: 1766898-1768379 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1482 bp · LXL04_026711|LXL04_026711|OH1004|cDNA

ATGTTATCAGAAGGGGTCAATCCAAATCGTATTACTTTCTTAAATTTAGTTAGCTTGTCGATTCAAGCAGGGGACTTTAAGATGGGTACGCAGCTCCATTGCCGGATAGCGAAATCGGGTTTCCGTAAAGATTGTCATGTGAATAGTTCTCTTGTTAAATTCTATTCCAAATTTGGATTTGTTAGCGAGGCGAAGctggtttttgatgattcggtGTATAAAGATTTGGTTTTGTGGAATGTAATGGTGTCTTGTTATTC...

CDS

Download CDS FASTA

1482 bp · LXL04_026711|LXL04_026711|OH1004|CDS

ATGTTATCAGAAGGGGTCAATCCAAATCGTATTACTTTCTTAAATTTAGTTAGCTTGTCGATTCAAGCAGGGGACTTTAAGATGGGTACGCAGCTCCATTGCCGGATAGCGAAATCGGGTTTCCGTAAAGATTGTCATGTGAATAGTTCTCTTGTTAAATTCTATTCCAAATTTGGATTTGTTAGCGAGGCGAAGCTGGTTTTTGATGATTCGGTGTATAAAGATTTGGTTTTGTGGAATGTAATGGTGTCTTGTTATTC...

Protein

Download Protein FASTA

493 aa · LXL04_026711|LXL04_026711|OH1004|PROTEIN

MLSEGVNPNRITFLNLVSLSIQAGDFKMGTQLHCRIAKSGFRKDCHVNSSLVKFYSKFGFVSEAKLVFDDSVYKDLVLWNVMVSCYSLNGLREDGFKVFLMMRSHGIKGDEFTYTSVVNCCVYLTDCDLGKQIHVLVFRFGFDRDMVLGSALTDMYAKNENINDARKVFDEMCQRNLISWNTMIVGYGHHNNGKEAIKLLRNMLKDDFTPDDLTLASVISSCGNLSLTCEIHELHSYSLKLGNISFLSVSNSLLNAYSKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_026711
TK1151 IDTkA07G002960
OH-1004 IDLXL04_026711
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)58.800
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_026711
LocationChr06:1766898-1768379 (-)
DescriptionSimilar to PCMP-E39: Pentatricopeptide repeat-containing protein At2g46050, mitochondrial
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At2g46050 Pentatricopeptide repeat-containing protein At2g46050, mitochondrial. No verified direct reference in this release
At1g68930 Putative pentatricopeptide repeat-containing protein At1g68930. No verified direct reference in this release
At2g13600 Pentatricopeptide repeat-containing protein At2g13600. No verified direct reference in this release
At5g13230 Putative pentatricopeptide repeat-containing protein At5g13230, mitochondrial. No verified direct reference in this release
At1g50270 Pentatricopeptide repeat-containing protein At1g50270. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026711 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0000963 mitochondrial RNA processing Biological Process
GO:0009451 RNA modification Biological Process
GO:0080156 mitochondrial mRNA modification Biological Process
GO:0005739 mitochondrion Cellular Component
GO:0003723 RNA binding Molecular Function
GO:0008270 zinc ion binding Molecular Function
KEGG gene cross-reference
ath:AT1G68930
ath:AT2G46050
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.674
Rank 1 · LXL04_026711 · OH-1004
Plastid0.144
Rank 2 · LXL04_026711 · OH-1004
Nucleus0.046
Rank 3 · LXL04_026711 · OH-1004
Cytoplasm0.031
Rank 4 · LXL04_026711 · OH-1004
Cell membrane0.005
Rank 5 · LXL04_026711 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041.13PPR_275-121 aa
PF01535.27PPR77-107 aa
PF13041.13PPR_2176-223 aa
PF01535.27PPR178-207 aa
PF12854.14PPR_1275-305 aa
PF13041.13PPR_2276-321 aa
PF01535.27PPR279-305 aa
PF20431.5E_motif391-453 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_026711PF13041.13PPR_2751213.6e-40136.6
LXL04_026711PF01535.27PPR771071.3e-40135.5
LXL04_026711PF13041.13PPR_21762233.6e-40136.6
LXL04_026711PF01535.27PPR1782071.3e-40135.5
LXL04_026711PF12854.14PPR_12753058.3e-2690.1
LXL04_026711PF13041.13PPR_22763213.6e-40136.6
LXL04_026711PF01535.27PPR2793051.3e-40135.5
LXL04_026711PF20431.5E_motif3914531.6e-1557.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
O82363Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g46050, mitochondrial44.469%Swiss-Protmoderate database homology
Q9CAA8Arabidopsis thalianaPutative pentatricopeptide repeat-containing protein At1g6893036.364%Swiss-Protmoderate database homology
Q9SIT7Arabidopsis thalianaPentatricopeptide repeat-containing protein At2g1360034.411%Swiss-Protmoderate database homology
Q9LYV3Arabidopsis thalianaPutative pentatricopeptide repeat-containing protein At5g13230, mitochondrial35.345%Swiss-Protmoderate database homology
Q9SX45Arabidopsis thalianaPentatricopeptide repeat-containing protein At1g5027034.783%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser