Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1389 bp · LXL04_026651|LXL04_026651|OH1004|cDNA
ATGGACCAATGTCAATCCAAAATCTATCAGGTAATCGCAAAACTTTTGGATGGTAAATCACGAACCCTAAACTTCGAAACCCCAATAATCCCAATTTCGTCAATCAAAGTACAAATCCAAAATCTTACATCGATCCCAGTACATCACCAACTCCTCTTATCCAACGGCAAAACACTTTTCGACGATGGCGTATTACACCACAGGAATTCTTCACCGTCAACGGTACACCTTCTGCTTCGTCTCCGTGGAGGTAAGGGTGG...
1389 bp · LXL04_026651|LXL04_026651|OH1004|CDS
ATGGACCAATGTCAATCCAAAATCTATCAGGTAATCGCAAAACTTTTGGATGGTAAATCACGAACCCTAAACTTCGAAACCCCAATAATCCCAATTTCGTCAATCAAAGTACAAATCCAAAATCTTACATCGATCCCAGTACATCACCAACTCCTCTTATCCAACGGCAAAACACTTTTCGACGATGGCGTATTACACCACAGGAATTCTTCACCGTCAACGGTACACCTTCTGCTTCGTCTCCGTGGAGGTAAGGGTGG...
Protein
Download Protein FASTA462 aa · LXL04_026651|LXL04_026651|OH1004|PROTEIN
MDQCQSKIYQVIAKLLDGKSRTLNFETPIIPISSIKVQIQNLTSIPVHHQLLLSNGKTLFDDGVLHHRNSSPSTVHLLLRLRGGKGGFGSLLRGAATKAGQKKTNNFDACRDMSGRRLRHVNAEKKMEEWLAEEKERKLEKVAEDFIKKKVKTVKKAGGGDGTEKYVEKYRKDSAKCMEEVDKSVRESLAGGFRKTKRTAAGVDVEHSGGSKSKKLKIWMGKRKVDDSDSDETDEEDSDDEMGEENEKSVVTNNENQSDS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_026651 |
|---|---|
| TK1151 ID | TkAUNG081520 |
| OH-1004 ID | LXL04_026651 |
| Relationship / confidence | Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_026651 |
|---|---|
| Location | Chr06:891560-893132 (-) |
| Description | Similar to sde2: Replication stress response regulator SDE2 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0000479 endonucleolytic cleavage of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0002181 cytoplasmic translation Biological Process GO:0006260 DNA replication Biological Process GO:0006412 translation Biological Process GO:0016485 protein processing Biological Process GO:0016567 protein ubiquitination Biological Process GO:0017085 response to insecticide Biological Process GO:0019941 modification-dependent protein catabolic process Biological Process GO:0031571 mitotic G1 DNA damage checkpoint signaling Biological Process GO:0034644 cellular response to UV Biological Process GO:0045292 mRNA cis splicing, via spliceosome Biological Process GO:0051301 cell division Biological Process |
| KEGG gene cross-reference | dre:550448 mmu:208768 oas:443296 ocu:127489798 rno:64156 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF22782.2SDE283-186 aaPF13297.12SDE2_2C391-460 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_026651 | PF22782.2 | SDE2 | 83 | 186 | 8.2e-25 | 88.3 |
| LXL04_026651 | PF13297.12 | SDE2_2C | 391 | 460 | 2.5e-27 | 95.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.