LXL04_026563 | RubberDandelionOmics

Gene overview

LXL04_026563

Reference: OH-1004 Chr: Chr05 Coordinates: 128336505-128340210 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

882 bp · LXL04_026563|LXL04_026563|OH1004|cDNA

CACCCCCACCCGACCCGTCTTTACCCCTTATCTGCTCCCCTTTTGTTGCTCATCTCATCTCATAAGTCCCTAAAAAGCAGATCCAAGGTGGTTGTTAATCTGTCAATTCACTACAATCAATCAACTCAAATCAATCAATCAATCATATCCCAACCCCCACATAAATCTCCGAACAAactaacaaaaaaaaacatgtcAATCTCGTCCTCCTCCACGACCTCCCCCACCGTGCCACAGTTCCTCCACCACCTCGCTCCTCC...

CDS

Download CDS FASTA

840 bp · LXL04_026563|LXL04_026563|OH1004|CDS

TTGTTGCTCATCTCATCTCATAAGTCCCTAAAAAGCAGATCCAAGGTGGTTGTTAATCTGTCAATTCACTACAATCAATCAACTCAAATCAATCAATCAATCATATCCCAACCCCCACATAAATCTCCGAACAAACTAACAAAAAAAAACATGTCAATCTCGTCCTCCTCCACGACCTCCCCCACCGTGCCACAGTTCCTCCACCACCTCGCTCCTCCTTCATGCTCCGATCAGCTCTGCTATGTCCAGTGCACTCACTG...

Protein

Download Protein FASTA

279 aa · LXL04_026563|LXL04_026563|OH1004|PROTEIN

MLLISSHKSLKSRSKVVVNLSIHYNQSTQINQSIISQPPHKSPNKLTKKNMSISSSSTTSPTVPQFLHHLAPPSCSDQLCYVQCTHCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPLSMPGLLLPPSVNQYHITHTNFFSPSNHTLLDDQIPNGASNFLINPNYANEFSLTARGGFRELPKPPVTNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQTTAVNKSSMRQQDHTD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026563`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026563

Location Chr05:128336505-128340210 (+)

Description Similar to YAB1: Axial regulator YABBY 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45190`	Involved in the abaxial cell fate determination during embryogenesis and organogenesis.	No verified direct reference in this release
`At4g00180`	Involved in the abaxial cell fate determination during embryogenesis and organogenesis.	YABBY polarity genes mediate the repression of KNOX homeobox genes in Arabidopsis.2002 · DOI: 10.1105/tpc.004911 YABBYs and the transcriptional corepressors LEUNIG and LEUNIG_HOMOLOG maintain leaf polarity and meristem activity in Arabidopsis.2009 · DOI: 10.1105/tpc.109.070458

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0643200`	Seems to be associated with phloem cell differentiation.	No verified direct reference in this release
`UniProt: A2X7Q3`	Protein YABBY 4.	No verified direct reference in this release
`Os04g0536300`	May be involved in leaf cell growth and differentiation, rather than abaxial cell fate determination.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026563 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0009933 meristem structural organization Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0010154 fruit development Biological Process

GO:0010158 abaxial cell fate specification Biological Process

GO:0010450 inflorescence meristem growth Biological Process

GO:0045165 cell fate commitment Biological Process

GO:0090706 specification of plant organ position Biological Process

GO:1902183 regulation of shoot apical meristem development Biological Process

GO:2000024 regulation of leaf development Biological Process

KEGG gene cross-reference

ath:AT2G45190

ath:AT4G00180

dosa:Os02g0643200

dosa:Os04g0536300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.845

Rank 1 · LXL04_026563 · OH-1004

Cytoplasm0.226

Rank 2 · LXL04_026563 · OH-1004

Cell membrane0.050

Rank 3 · LXL04_026563 · OH-1004

Endoplasmic reticulum0.047

Rank 4 · LXL04_026563 · OH-1004

Plastid0.019

Rank 5 · LXL04_026563 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24868.1YABBY_N75-124 aa

PF04690.20YABBY180-239 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026563	`PF24868.1`	YABBY_N	75	124	1.5e-23	82.8
LXL04_026563	`PF04690.20`	YABBY	180	239	5.8e-37	126.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22152`	Arabidopsis thaliana	Axial regulator YABBY 1	57.870%	Swiss-Prot	strong database homology
`Q9XFB1`	Arabidopsis thaliana	Axial regulator YABBY 3	57.919%	Swiss-Prot	strong database homology
`Q6H668`	Oryza sativa subsp. japonica	Protein YABBY 4	52.227%	Swiss-Prot	strong database homology
`A2X7Q3`	Oryza sativa subsp. indica	Protein YABBY 4	52.227%	Swiss-Prot	strong database homology
`Q0JBF0`	Oryza sativa subsp. japonica	Protein YABBY 5	48.750%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card