LXL04_026515 | RubberDandelionOmics

Gene overview

LXL04_026515

Reference: OH-1004 Chr: Chr05 Coordinates: 127578797-127583102 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2727 bp · LXL04_026515|LXL04_026515|OH1004|cDNA

ATGGCAAATAATCATAGTTATAAGAATGGCGGTGTGAAGACGAAGTCAATCTCATCTGCATCTTCATCTTATTCTTCTGGTAACAAATCTAAGCCGTCGGCAACCTCTGCGGGCCGCCGTAACAGCACCGGTTCCACTGGTAATTCCGCCGGTACACTTCACAAGGACACTCCTGGAGTATCCGGGAGAGTCCGAGTGGCTGTAAGATTACGACCACGAAACAGTGAGGAACAATCAACCGATGCTGATTTCGCCGATTG...

CDS

Download CDS FASTA

2727 bp · LXL04_026515|LXL04_026515|OH1004|CDS

ATGGCAAATAATCATAGTTATAAGAATGGCGGTGTGAAGACGAAGTCAATCTCATCTGCATCTTCATCTTATTCTTCTGGTAACAAATCTAAGCCGTCGGCAACCTCTGCGGGCCGCCGTAACAGCACCGGTTCCACTGGTAATTCCGCCGGTACACTTCACAAGGACACTCCTGGAGTATCCGGGAGAGTCCGAGTGGCTGTAAGATTACGACCACGAAACAGTGAGGAACAATCAACCGATGCTGATTTCGCCGATTG...

Protein

Download Protein FASTA

908 aa · LXL04_026515|LXL04_026515|OH1004|PROTEIN

MANNHSYKNGGVKTKSISSASSSYSSGNKSKPSATSAGRRNSTGSTGNSAGTLHKDTPGVSGRVRVAVRLRPRNSEEQSTDADFADCVELQPELKRLKLRRNNWDSDTFEFDEVLTEFASQKRVYEVVAKPVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGDEDTSARGIMVRAMEDLFAEISPETDSISVSYLQLYMETIQDLLDPTNDNLSIMEDPKNGDISLPGATLIEVRDQQSFIELLRLGEAHRFAANTKLNT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026515`
TK1151 ID	TkA06G007510
OH-1004 ID	LXL04_026515
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026515

Location Chr05:127578797-127583102 (+)

Description Similar to KINUA: Kinesin-like protein KIN-UA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12430`	Kinesin-like protein KIN-UA.	No verified direct reference in this release
`At1g01950`	Involved in the control of epidermal-cell morphogenesis in roots and helical growth of roots by promoting microtubule depolymerization and limiting the accumulation of endoplasmic microtubules.	No verified direct reference in this release
`At3g54870`	Acts as a plus-end microtubule-dependent motor protein.	A mutation in MRH2 kinesin enhances the root hair tip growth defect caused by constitutively activated ROP2 small GTPase in Arabidopsis.2007 · DOI: 10.1371/journal.pone.0001074

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0137100`	Kinesin-like protein KIN-UB.	No verified direct reference in this release
`Os03g0152900`	Kinesin-like protein KIN-UA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026515 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0030705 cytoskeleton-dependent intracellular transport Biological Process

GO:0031110 regulation of microtubule polymerization or depolymerization Biological Process

GO:0048364 root development Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005819 spindle Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G01950

ath:AT1G12430

ath:AT3G54870

dosa:Os03g0152900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.557

Rank 1 · LXL04_026515 · OH-1004

Nucleus0.334

Rank 2 · LXL04_026515 · OH-1004

Cell membrane0.202

Rank 3 · LXL04_026515 · OH-1004

Lysosome / Vacuole0.066

Rank 4 · LXL04_026515 · OH-1004

Golgi apparatus0.063

Rank 5 · LXL04_026515 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796.12Microtub_bd60-206 aa

PF00225.30Kinesin69-406 aa

PF24768.2ARM_ARMC5673-875 aa

PF00514.30Arm684-720 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026515	`PF16796.12`	Microtub_bd	60	206	1e-18	68.4
LXL04_026515	`PF00225.30`	Kinesin	69	406	3.5e-99	332.6
LXL04_026515	`PF24768.2`	ARM_ARMC5	673	875	2.7e-15	57.2
LXL04_026515	`PF00514.30`	Arm	684	720	4.8e-20	71.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FZ06`	Arabidopsis thaliana	Kinesin-like protein KIN-UA	71.021%	Swiss-Prot	strong database homology
`Q9LPC6`	Arabidopsis thaliana	Kinesin-like protein KIN-UB	66.593%	Swiss-Prot	strong database homology
`Q9SV36`	Arabidopsis thaliana	Kinesin-like protein KIN-UC	59.811%	Swiss-Prot	weak database homology
`Q5VQ09`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-UB	68.549%	Swiss-Prot	strong database homology
`Q0DV28`	Oryza sativa subsp. japonica	Kinesin-like protein KIN-UA	49.889%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card