LXL04_026507 | RubberDandelionOmics

Gene overview

LXL04_026507

Reference: OH-1004 Chr: Chr05 Coordinates: 127501326-127502396 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1071 bp · LXL04_026507|LXL04_026507|OH1004|cDNA

ATGGTGGAGGCTCAATCATGGACCACTCGCCGGAGCAGTAATCCTAGGCTAGAAACCTCCGTCGACATCCCAAACACGCCTACCGGCGAAGTCCGCTACGGCACCAGCAACAACATTTTCGCGGCGTTATCTGTCACATCAATCGTTTCTCCGGCAATTTTAACTTCTCTGATCATCGCGTCGTGGTACTTTTCAAACATTGGCGTCCTCCTCCTCAACAAATACCTTCTCAGCTACTATGGATTTAGATACCCGATCTT...

CDS

Download CDS FASTA

1071 bp · LXL04_026507|LXL04_026507|OH1004|CDS

ATGGTGGAGGCTCAATCATGGACCACTCGCCGGAGCAGTAATCCTAGGCTAGAAACCTCCGTCGACATCCCAAACACGCCTACCGGCGAAGTCCGCTACGGCACCAGCAACAACATTTTCGCGGCGTTATCTGTCACATCAATCGTTTCTCCGGCAATTTTAACTTCTCTGATCATCGCGTCGTGGTACTTTTCAAACATTGGCGTCCTCCTCCTCAACAAATACCTTCTCAGCTACTATGGATTTAGATACCCGATCTT...

Protein

Download Protein FASTA

356 aa · LXL04_026507|LXL04_026507|OH1004|PROTEIN

MVEAQSWTTRRSSNPRLETSVDIPNTPTGEVRYGTSNNIFAALSVTSIVSPAILTSLIIASWYFSNIGVLLLNKYLLSYYGFRYPIFLTMLHMISCTFYSLIAIRWFQIVPFQQILSRKQFFKIFALSAIFCFSVVCGNTSLRYLPVSFNQAIGATTPFFTAIFSFLITCKKESAGVYFALMPVVFGIVLASNSEPLFHLFGFLMCVGSTAGRALKSVVQGLLLTSDSEKLHSMNLLLYMAPMAAAILLPFTLYIEGNVL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026507`
TK1151 ID	TkA06G007760
OH-1004 ID	LXL04_026507
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026507

Location Chr05:127501326-127502396 (+)

Description Similar to At1g12500: Probable sugar phosphate/phosphate translocator At1g12500

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12500`	Probable sugar phosphate/phosphate translocator At1g12500.	No verified direct reference in this release
`At5g05820`	Probable sugar phosphate/phosphate translocator At5g05820.	No verified direct reference in this release
`At3g11320`	Probable sugar phosphate/phosphate translocator At3g11320.	No verified direct reference in this release
`At5g04160`	UDP-glucuronic acid transporter that modulates the polysaccharide composition of seed mucilage.	UUAT1 Is a Golgi-Localized UDP-Uronic Acid Transporter That Modulates the Polysaccharide Composition of Arabidopsis Seed Mucilage.2017 · DOI: 10.1105/tpc.16.00465
`At3g10290`	Probable sugar phosphate/phosphate translocator At3g10290.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026507 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015780 nucleotide-sugar transmembrane transport Biological Process

GO:0055085 transmembrane transport Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0015297 antiporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G12500

ath:AT3G10290

ath:AT3G11320

ath:AT5G04160

ath:AT5G05820

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.571

Rank 1 · LXL04_026507 · OH-1004

Endoplasmic reticulum0.181

Rank 2 · LXL04_026507 · OH-1004

Cytoplasm0.110

Rank 3 · LXL04_026507 · OH-1004

Lysosome / Vacuole0.078

Rank 4 · LXL04_026507 · OH-1004

Cell membrane0.059

Rank 5 · LXL04_026507 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03151.23TPT56-345 aa

PF08449.18UAA74-346 aa

PF00892.27EamA84-192 aa

PF00892.27EamA220-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026507	`PF03151.23`	TPT	56	345	2.2e-46	159.3
LXL04_026507	`PF08449.18`	UAA	74	346	5.7e-09	36.2
LXL04_026507	`PF00892.27`	EamA	84	192	4.1e-10	40.8
LXL04_026507	`PF00892.27`	EamA	220	344	4.1e-10	40.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDH3`	Arabidopsis thaliana	Probable sugar phosphate/phosphate translocator At1g12500	74.722%	Swiss-Prot	strong database homology
`Q6DBP3`	Arabidopsis thaliana	Probable sugar phosphate/phosphate translocator At5g05820	66.780%	Swiss-Prot	strong database homology
`Q5XF09`	Arabidopsis thaliana	Probable sugar phosphate/phosphate translocator At3g11320	66.441%	Swiss-Prot	strong database homology
`Q9FYE5`	Arabidopsis thaliana	UDP-URONIC ACID TRANSPORTER 1	61.017%	Swiss-Prot	strong database homology
`Q9SS40`	Arabidopsis thaliana	Probable sugar phosphate/phosphate translocator At3g10290	58.586%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card