LXL04_026496 | RubberDandelionOmics

Gene overview

LXL04_026496

Reference: OH-1004 Chr: Chr05 Coordinates: 127375378-127378058 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

897 bp · LXL04_026496|LXL04_026496|OH1004|cDNA

ATGCAAGAACAAGGATTAGGGATGATTGGTGGCAGTGGAGGGATTGGTGGTGCTTTTACAGATATGGCCGTCTCACTTTCCGGCGATCAGAACCGCCAGCTCAAGGCGGAGATAGCCAACCACCCACTCTACGAACAGCTTCTCTCAGCTCATGTAGCATGTCTCCGGGTCGCCACGCCGATTGATCAGCTGCCGCTCATCGACGCCCAGCTCTCCCAGTCCCACCACCTCCTCCGCTCTTACATCGCCGACCACCACAA...

CDS

Download CDS FASTA

897 bp · LXL04_026496|LXL04_026496|OH1004|CDS

ATGCAAGAACAAGGATTAGGGATGATTGGTGGCAGTGGAGGGATTGGTGGTGCTTTTACAGATATGGCCGTCTCACTTTCCGGCGATCAGAACCGCCAGCTCAAGGCGGAGATAGCCAACCACCCACTCTACGAACAGCTTCTCTCAGCTCATGTAGCATGTCTCCGGGTCGCCACGCCGATTGATCAGCTGCCGCTCATCGACGCCCAGCTCTCCCAGTCCCACCACCTCCTCCGCTCTTACATCGCCGACCACCACAA...

Protein

Download Protein FASTA

298 aa · LXL04_026496|LXL04_026496|OH1004|PROTEIN

MQEQGLGMIGGSGGIGGAFTDMAVSLSGDQNRQLKAEIANHPLYEQLLSAHVACLRVATPIDQLPLIDAQLSQSHHLLRSYIADHHNQPLSPHDRQDLDNFLAQYLLVLCSFKEQLQQHVRVHAVEAVMACREIEHNLQALTGVTLGEGSGATMSDDEDEMPMDFSLDQSGGMDGGHDMMGFGPLLPTESERSLMERVRQELKIELKQGFRSKIEDVREEILRKRRAGKLPGDTTSVLKDWWQQHSKWPYPTEDDKAKLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026496`
TK1151 ID	TkA06G008720
OH-1004 ID	LXL04_026496
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026496

Location Chr05:127375378-127378058 (-)

Description Similar to KNAT7: Homeobox protein knotted-1-like 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g62990`	May be involved in secondary cell wall biosynthesis.	No verified direct reference in this release
`At5g25220`	Homeobox protein knotted-1-like 3.	No verified direct reference in this release
`At5g11060`	Homeobox protein knotted-1-like 4.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0123500`	Homeobox protein knotted-1-like 3.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026496 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009722 detection of cytokinin stimulus Biological Process

GO:0010089 xylem development Biological Process

GO:0010192 mucilage biosynthetic process Biological Process

GO:0010214 seed coat development Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0071345 cellular response to cytokine stimulus Biological Process

GO:0080001 mucilage extrusion from seed coat Biological Process

GO:0080112 seed growth Biological Process

GO:2000652 regulation of secondary cell wall biogenesis Biological Process

KEGG gene cross-reference

ath:AT1G62990

ath:AT5G11060

ath:AT5G25220

bna:106394496

dosa:Os03g0123500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.962

Rank 1 · LXL04_026496 · OH-1004

Cytoplasm0.176

Rank 2 · LXL04_026496 · OH-1004

Mitochondrion0.019

Rank 3 · LXL04_026496 · OH-1004

Cell membrane0.014

Rank 4 · LXL04_026496 · OH-1004

Golgi apparatus0.007

Rank 5 · LXL04_026496 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03790.19KNOX134-75 aa

PF03791.19KNOX292-142 aa

PF05920.18Homeobox_KN241-280 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026496	`PF03790.19`	KNOX1	34	75	2e-19	69.8
LXL04_026496	`PF03791.19`	KNOX2	92	142	4e-17	62.2
LXL04_026496	`PF05920.18`	Homeobox_KN	241	280	1.8e-19	70.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FPQ8`	Arabidopsis thaliana	Homeobox protein knotted-1-like 7	77.741%	Swiss-Prot	strong database homology
`P48000`	Arabidopsis thaliana	Homeobox protein knotted-1-like 3	69.825%	Swiss-Prot	strong database homology
`P48001`	Arabidopsis thaliana	Homeobox protein knotted-1-like 4	70.632%	Swiss-Prot	strong database homology
`Q94LW3`	Oryza sativa subsp. japonica	Homeobox protein knotted-1-like 3	77.860%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card