LXL04_026447 | RubberDandelionOmics

Gene overview

LXL04_026447

Reference: OH-1004 Chr: Chr05 Coordinates: 126416689-126418163 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

807 bp · LXL04_026447|LXL04_026447|OH1004|cDNA

ATGgatacaaagaTGCTGCAAGGTAGTGTATTGGCAATCACCGACAATGCAGTGTTGTCACTTGATGAAGCTCTGAGTGCTGTAAAAATGGTGAAGAAGGAGGTGGTTCAGGAGCTCAATCCTTTGATTATCAATCAAGCTGCATCTCTAAGTACTTTACCATTGGATGCATCATCCACTGACTTCATCATATCCATCAGCAAGTCATCAGATTTTCCTGGTGATAAGCTGTTTGAGGAATTCTCAAGGGTGTTAAAGCC...

CDS

Download CDS FASTA

807 bp · LXL04_026447|LXL04_026447|OH1004|CDS

ATGGATACAAAGATGCTGCAAGGTAGTGTATTGGCAATCACCGACAATGCAGTGTTGTCACTTGATGAAGCTCTGAGTGCTGTAAAAATGGTGAAGAAGGAGGTGGTTCAGGAGCTCAATCCTTTGATTATCAATCAAGCTGCATCTCTAAGTACTTTACCATTGGATGCATCATCCACTGACTTCATCATATCCATCAGCAAGTCATCAGATTTTCCTGGTGATAAGCTGTTTGAGGAATTCTCAAGGGTGTTAAAGCC...

Protein

Download Protein FASTA

268 aa · LXL04_026447|LXL04_026447|OH1004|PROTEIN

MDTKMLQGSVLAITDNAVLSLDEALSAVKMVKKEVVQELNPLIINQAASLSTLPLDASSTDFIISISKSSDFPGDKLFEEFSRVLKPGGEIFIHQTSAVSKESIKSSLERKLLVVGFSDIQVVDMAEVESFGIKCKKPSWKIGSSFSLKKPVKSLPKVQLVDDMDLIDEDSLLSEEDLKKPQLPPVSDCEVGVTKKACKNCSCGRAEEEEKVAKLGVTMDQLENPKSSCGSCGLGDAFRCGTCPYKGLPPFKLGQKVTLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026447`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026447

Location Chr05:126416689-126418163 (-)

Description Similar to VIT_01s0010g01180: Anamorsin homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18400`	Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026447 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0009055 electron transfer activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0051537 2 iron, 2 sulfur cluster binding Molecular Function

GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function

KEGG gene cross-reference

ath:AT5G18400

mtr:11444383

pop:7492497

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.654

Rank 1 · LXL04_026447 · OH-1004

Nucleus0.513

Rank 2 · LXL04_026447 · OH-1004

Mitochondrion0.063

Rank 3 · LXL04_026447 · OH-1004

Peroxisome0.039

Rank 4 · LXL04_026447 · OH-1004

Endoplasmic reticulum0.029

Rank 5 · LXL04_026447 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08241.19Methyltransf_1116-93 aa

PF20922.4Anamorsin_N27-129 aa

PF05093.19CIAPIN1222-259 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026447	`PF08241.19`	Methyltransf_11	16	93	3.1e-06	28.5
LXL04_026447	`PF20922.4`	Anamorsin_N	27	129	7e-08	33.1
LXL04_026447	`PF05093.19`	CIAPIN1	222	259	2.1e-17	64.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L7Z3`	Arabidopsis thaliana	Anamorsin homolog	59.489%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card