RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_026419
Reference: OH-1004 Chr: Chr05 Coordinates: 126071269-126071763 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

495 bp · LXL04_026419|LXL04_026419|OH1004|cDNA

ATGGGGTTCCCAGTAGGCTACACAGAGCTCTTCCTCCCCAAAATCCTCATCCATGTTCTAACATTTATGGGTCTAATTCGTAAGCTCATTTCCGCCGTTTTTCGATTTGTGGGTCTCGGGGATTTCTTAGAACCCGAATTTTCCACTGACCCGACCCGAATGGAGTCTTTTAGTCAGTTCCGGTCGGTGTCCGTTTTGCTCATCCGCGAGCTTCTTCCGGTTGTGAAATTCTCAGAGCTTGTGGATCCGCCGGAGAGCTG...

CDS

Download CDS FASTA

495 bp · LXL04_026419|LXL04_026419|OH1004|CDS

ATGGGGTTCCCAGTAGGCTACACAGAGCTCTTCCTCCCCAAAATCCTCATCCATGTTCTAACATTTATGGGTCTAATTCGTAAGCTCATTTCCGCCGTTTTTCGATTTGTGGGTCTCGGGGATTTCTTAGAACCCGAATTTTCCACTGACCCGACCCGAATGGAGTCTTTTAGTCAGTTCCGGTCGGTGTCCGTTTTGCTCATCCGCGAGCTTCTTCCGGTTGTGAAATTCTCAGAGCTTGTGGATCCGCCGGAGAGCTG...

Protein

Download Protein FASTA

164 aa · LXL04_026419|LXL04_026419|OH1004|PROTEIN

MGFPVGYTELFLPKILIHVLTFMGLIRKLISAVFRFVGLGDFLEPEFSTDPTRMESFSQFRSVSVLLIRELLPVVKFSELVDPPESCAVCLYEFDGGDEIRQLSNCRHVFHRCCLDRWMDHDQKTCPLCRTPLIPDDLQDSFNERLWAASGIAEYYGEPPVVSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_026419
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_026419
LocationChr05:126071269-126071763 (+)
DescriptionSimilar to BRH1: Brassinosteroid-responsive RING protein 1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g61460 May be involved in the brassinosteroids (BRs) signaling pathway and regulate the growth and development of rosette leaves.
Characterisation of BRH1, a brassinosteroid-responsive RING-H2 gene from Arabidopsis thaliana.2002 · DOI: 10.1007/s00425-001-0723-z
Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana.2018 · DOI: 10.1007/s11427-017-9133-8
At4g11360 Possesses E3 ubiquitin-protein ligase activity when associated with the E2 enzyme UBC8 in vitro. No verified direct reference in this release
At4g11370 Probable E3 ubiquitin-protein ligase that may possess E3 ubiquitin ligase activity in vitro. No verified direct reference in this release
At2g04240 Function on abscisic acid homeostasis at post-translational level, probably through ubiquitin/proteasome-dependent substrate- specific degradation.
Upregulation of an Arabidopsis RING-H2 gene, XERICO, confers drought tolerance through increased abscisic acid biosynthesis.2006 · DOI: 10.1111/j.1365-313x.2006.02782.x
Global analysis of della direct targets in early gibberellin signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.107.054999
At2g01150 E3 ubiquitin-protein ligase involved in the positive regulation of abscisic acid (ABA) signaling and responses to salt and osmotic stresses during seed germination and early seedling development.
The Arabidopsis RING finger E3 ligase RHA2b acts additively with RHA2a in regulating abscisic acid signaling and drought response.2011 · DOI: 10.1104/pp.111.176214

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026419 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006970 response to osmotic stress Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009687 abscisic acid metabolic process Biological Process
GO:0009688 abscisic acid biosynthetic process Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009739 response to gibberellin Biological Process
GO:0009741 response to brassinosteroid Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process
GO:0010200 response to chitin Biological Process
GO:0016567 protein ubiquitination Biological Process
GO:0047484 regulation of response to osmotic stress Biological Process
KEGG gene cross-reference
ath:AT2G01150
ath:AT2G04240
ath:AT3G61460
ath:AT4G11360
ath:AT4G11370
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.298
Rank 1 · LXL04_026419 · OH-1004
Cytoplasm0.264
Rank 2 · LXL04_026419 · OH-1004
Golgi apparatus0.219
Rank 3 · LXL04_026419 · OH-1004
Nucleus0.196
Rank 4 · LXL04_026419 · OH-1004
Lysosome / Vacuole0.185
Rank 5 · LXL04_026419 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_286-130 aa
PF17123.12zf-RING_1187-115 aa
PF13923.13zf-C3HC4_287-129 aa
PF00097.32zf-C3HC487-129 aa
PF12678.14zf-rbx1100-130 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_026419PF13639.13zf-RING_2861305.8e-1349.6
LXL04_026419PF17123.12zf-RING_11871153.5e-0730.5
LXL04_026419PF13923.13zf-C3HC4_2871291.7e-0628.4
LXL04_026419PF00097.32zf-C3HC4871293.5e-0627.5
LXL04_026419PF12678.14zf-rbx11001302.2e-0731.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9XF92Arabidopsis thalianaBrassinosteroid-responsive RING protein 160.241%Swiss-Protstrong database homology
Q9SUS5Arabidopsis thalianaE3 ubiquitin-protein ligase RHA1B39.610%Swiss-Protmoderate database homology
Q9SUS4Arabidopsis thalianaProbable E3 ubiquitin-protein ligase RHA1A35.714%Swiss-Protmoderate database homology
Q9SI09Arabidopsis thalianaProbable E3 ubiquitin-protein ligase XERICO43.210%Swiss-Protweak database homology
Q9ZU51Arabidopsis thalianaE3 ubiquitin-protein ligase RHA2B46.552%Swiss-Protweak database homology

JBrowse

View in Genome Browser