LXL04_026321 | RubberDandelionOmics

Gene overview

LXL04_026321

Reference: OH-1004 Chr: Chr05 Coordinates: 124847568-124850950 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1866 bp · LXL04_026321|LXL04_026321|OH1004|cDNA

atgGAGAATTTGATAAGTTTAGTGAACAAACTACAGAGAGCATGCACAGCATTAGGCGATCACGGAGACGCGACGTCATTGCCCACTCTCTGGGACTCTTTGCCCTCCATTGCCGTTGTTGGTGGTCAGAGTTCAGGGAAATCTTCCGTTTTAGAAAGTATTGTCGGCAAAGACTTTTTGCCACGAGGATCAGGAATCGTTACTAGACGGCCATTGGTTTTGCAGCTTCATAAAATAGACGAAGGGAAAGAATACGCAGA...

CDS

Download CDS FASTA

1605 bp · LXL04_026321|LXL04_026321|OH1004|CDS

ATGGAGAATTTGATAAGTTTAGTGAACAAACTACAGAGAGCATGCACAGCATTAGGCGATCACGGAGACGCGACGTCATTGCCCACTCTCTGGGACTCTTTGCCCTCCATTGCCGTTGTTGGTGGTCAGAGTTCAGGGAAATCTTCCGTTTTAGAAAGTATTGTCGGCAAAGACTTTTTGCCACGAGGATCAGGAATCGTTACTAGACGGCCATTGGTTTTGCAGCTTCATAAAATAGACGAAGGGAAAGAATACGCAGA...

Protein

Download Protein FASTA

534 aa · LXL04_026321|LXL04_026321|OH1004|PROTEIN

MENLISLVNKLQRACTALGDHGDATSLPTLWDSLPSIAVVGGQSSGKSSVLESIVGKDFLPRGSGIVTRRPLVLQLHKIDEGKEYAEFLHLRSKKFYDFVAVRKEISDETDRETGQTKQISSVPIHLSIYSPNVVNLTLVDLPGLTKVAVDGQSESIVQDIENMLRAYIQKPNCIILAISPANQDLATSDAIKMSREVDPIGERTIGVLTKIDLMDKGTDAVDILEGKSYRLKFPWVGVVNRSQQDINKRVDMTSARLKE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026321`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026321

Location Chr05:124847568-124850950 (-)

Description Similar to Dynamin-related protein 5A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42080`	Microtubule-associated force-producing protein that is targeted to at the leading edges of the forming cell plate during cytokinesis.	The arabidopsis cell plate-associated dynamin-like protein, ADL1Ap, is required for multiple stages of plant growth and development.2001 · DOI: 10.1104/pp.126.1.47 Members of the Arabidopsis dynamin-like gene family, ADL1, are essential for plant cytokinesis and polarized cell growth.2003 · DOI: 10.1105/tpc.009670 Phragmoplastin dynamics: multiple forms, microtubule association and their roles in cell plate formation in plants.2003 · DOI: 10.1023/b:plan.0000006936.50532.3a DRP1A is responsible for vascular continuity synergistically working with VAN3 in Arabidopsis.2005 · DOI: 10.1104/pp.105.061689 Arabidopsis dynamin-like protein DRP1A: a null mutant with widespread defects in endocytosis, cellulose synthesis, cytokinesis, and cell expansion.2008 · DOI: 10.1093/jxb/erm324 Comparison of the dynamics and functional redundancy of the Arabidopsis dynamin-related isoforms DRP1A and DRP1C during plant development.2008 · DOI: 10.1104/pp.108.116863 Arabidopsis dynamin-related protein DRP2B is co-localized with DRP1A on the leading edge of the forming cell plate.2008 · DOI: 10.1007/s00299-008-0583-0 Arabidopsis dynamin-related protein 1A polymers bind, but do not tubulate, liposomes.2010 · DOI: 10.1016/j.bbrc.2010.02.070 Arabidopsis dynamin-related proteins DRP2B and DRP1A participate together in clathrin-coated vesicle formation during endocytosis.2010 · DOI: 10.1073/pnas.0913562107 High lipid order of Arabidopsis cell-plate membranes mediated by sterol and DYNAMIN-RELATED PROTEIN1A function.2014 · DOI: 10.1111/tpj.12674 Arabidopsis D6PK is a lipid domain-dependent mediator of root epidermal planar polarity.2015 · DOI: 10.1038/nplants.2015.162 DRP1-Dependent Endocytosis is Essential for Polar Localization and Boron-Induced Degradation of the Borate Transporter BOR1 in Arabidopsis thaliana.2016 · DOI: 10.1093/pcp/pcw121 SH3 Domain-Containing Protein 2 Plays a Crucial Role at the Step of Membrane Tubulation during Cell Plate Formation.2017 · DOI: 10.1105/tpc.17.00108
`At3g61760`	Microtubule-associated force-producing protein that is targeted to at the leading edges of the forming cell plate during cytokinesis.	No verified direct reference in this release
`At3g60190`	Microtubule-associated force-producing protein that is targeted to the tubulo-vesicular network of the forming cell plate during cytokinesis.	Members of the Arabidopsis dynamin-like gene family, ADL1, are essential for plant cytokinesis and polarized cell growth.2003 · DOI: 10.1105/tpc.009670 Phragmoplastin dynamics: multiple forms, microtubule association and their roles in cell plate formation in plants.2003 · DOI: 10.1023/b:plan.0000006936.50532.3a

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026321 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006886 intracellular protein transport Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009920 cell plate formation involved in plant-type cell wall biogenesis Biological Process

GO:0010036 response to boron-containing substance Biological Process

GO:0010051 xylem and phloem pattern formation Biological Process

GO:0010091 trichome branching Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0030100 regulation of endocytosis Biological Process

GO:0048480 stigma development Biological Process

GO:0048766 root hair initiation Biological Process

GO:0050832 defense response to fungus Biological Process

KEGG gene cross-reference

ath:AT3G60190

ath:AT3G61760

ath:AT5G42080

gmx:100037461

gmx:547855

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.594

Rank 1 · LXL04_026321 · OH-1004

Nucleus0.208

Rank 2 · LXL04_026321 · OH-1004

Mitochondrion0.162

Rank 3 · LXL04_026321 · OH-1004

Peroxisome0.144

Rank 4 · LXL04_026321 · OH-1004

Cell membrane0.079

Rank 5 · LXL04_026321 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00350.30Dynamin_N37-212 aa

PF01031.26Dynamin_M220-487 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026321	`PF00350.30`	Dynamin_N	37	212	5.4e-55	186.7
LXL04_026321	`PF01031.26`	Dynamin_M	220	487	2.2e-65	221.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42697`	Arabidopsis thaliana	Phragmoplastin DRP1A	77.905%	Swiss-Prot	strong database homology
`Q84XF3`	Arabidopsis thaliana	Phragmoplastin DRP1B	75.619%	Swiss-Prot	strong database homology
`Q9FNX5`	Arabidopsis thaliana	Phragmoplastin DRP1E	63.653%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card