LXL04_026272 | RubberDandelionOmics

Gene overview

LXL04_026272

Reference: OH-1004 Chr: Chr05 Coordinates: 124182933-124184969 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1488 bp · LXL04_026272|LXL04_026272|OH1004|cDNA

ATGACTAACAAGAATGGAGTTGAATGGAGTATCAGGATGAGTGATGGATCATCAATGGTATTGGAGCCAGAACACAAGAATAGAGCCATGAGAATATGGGATGGATTAAAGGGATTGTTTATGAGGTTTGTAATGAGAATATGGAACTTCTTCAAGAAAGCATGGGCTTTAGGAGTCGATGAACCTAGAAAATTCTTTCATTGTCTTAAAGTTGGCGTAGCTTTGATGGTTGTCTCATTGTTTTACTATATGAGACCTTT...

CDS

Download CDS FASTA

1488 bp · LXL04_026272|LXL04_026272|OH1004|CDS

ATGACTAACAAGAATGGAGTTGAATGGAGTATCAGGATGAGTGATGGATCATCAATGGTATTGGAGCCAGAACACAAGAATAGAGCCATGAGAATATGGGATGGATTAAAGGGATTGTTTATGAGGTTTGTAATGAGAATATGGAACTTCTTCAAGAAAGCATGGGCTTTAGGAGTCGATGAACCTAGAAAATTCTTTCATTGTCTTAAAGTTGGCGTAGCTTTGATGGTTGTCTCATTGTTTTACTATATGAGACCTTT...

Protein

Download Protein FASTA

495 aa · LXL04_026272|LXL04_026272|OH1004|PROTEIN

MTNKNGVEWSIRMSDGSSMVLEPEHKNRAMRIWDGLKGLFMRFVMRIWNFFKKAWALGVDEPRKFFHCLKVGVALMVVSLFYYMRPLYDGVGGSAIWAVMTVVVVFEYTVGGTLYKCLNRICATFLAGFLALGIHWVASHSGHQLEPFIMGTSLFILASATTFSRFIPVVKARFDYGCTIFILTYSLISVSGYRVEHLLQVAHERLSTIIIGTCLCIITSMLVFPVWAGTELHLLIPRNMDKLAKSLDCCVADYFGHDDE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026272`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026272

Location Chr05:124182933-124184969 (-)

Description Similar to ALMT10: Aluminum-activated malate transporter 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00910`	Malate transporter.	No verified direct reference in this release
`At1g08440`	Malate transporter.	No verified direct reference in this release
`At3g11680`	Malate transporter.	No verified direct reference in this release
`At2g27240`	Malate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026272 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT1G08440

ath:AT2G27240

ath:AT3G11680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.870

Rank 1 · LXL04_026272 · OH-1004

Endoplasmic reticulum0.093

Rank 2 · LXL04_026272 · OH-1004

Cytoplasm0.061

Rank 3 · LXL04_026272 · OH-1004

Lysosome / Vacuole0.035

Rank 4 · LXL04_026272 · OH-1004

Nucleus0.030

Rank 5 · LXL04_026272 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11744.15ALMT55-421 aa

PF13515.13FUSC_293-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026272	`PF11744.15`	ALMT	55	421	6.5e-146	487.6
LXL04_026272	`PF13515.13`	FUSC_2	93	217	9.3e-09	36.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23086`	Arabidopsis thaliana	Aluminum-activated malate transporter 10	49.495%	Swiss-Prot	moderate database homology
`Q9SJE8`	Arabidopsis thaliana	Aluminum-activated malate transporter 2	44.886%	Swiss-Prot	moderate database homology
`Q9SRM9`	Arabidopsis thaliana	Aluminum-activated malate transporter 8	39.857%	Swiss-Prot	moderate database homology
`Q9XIN1`	Arabidopsis thaliana	Aluminum-activated malate transporter 7	38.395%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card