LXL04_026254 | RubberDandelionOmics

Gene overview

LXL04_026254

Reference: OH-1004 Chr: Chr05 Coordinates: 123916760-123919322 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1402 bp · LXL04_026254|LXL04_026254|OH1004|cDNA

AAAAATACAAGGGGGGAAGGGACTCGGGTctatcgggatggattggctcaCCGATTGCGGCGTCGCCTGAGTATCCAAGTTTGTGGGGTAGAATAGCCGTCCAGCGGATCCTATTATACCCATGGCCATACTCTCCATCGCCGCCCTCGCTACCAAATGCCAATTCTTCGCACCGTCTATTCCGGCCATCCCCTCTTTAAAAGCCTACCCCTTTTCCTCAACCATAACTCGATACACCACCATCGCTGCAACCATGTCTG...

CDS

Download CDS FASTA

1281 bp · LXL04_026254|LXL04_026254|OH1004|CDS

ATGGCCATACTCTCCATCGCCGCCCTCGCTACCAAATGCCAATTCTTCGCACCGTCTATTCCGGCCATCCCCTCTTTAAAAGCCTACCCCTTTTCCTCAACCATAACTCGATACACCACCATCGCTGCAACCATGTCTGCCAAGCCTCTTAAATCTCAACCTCACCCTTCTCTCGAGGTCACCGGCGGAGCTTTGGATACATTTCTTCCAGCTTTCACGACCCTCGATCGTCCTTACGATGCATATCCTTTCGTTTGTTC...

Protein

Download Protein FASTA

426 aa · LXL04_026254|LXL04_026254|OH1004|PROTEIN

MAILSIAALATKCQFFAPSIPAIPSLKAYPFSSTITRYTTIAATMSAKPLKSQPHPSLEVTGGALDTFLPAFTTLDRPYDAYPFVCSNTHLETIFAHYFRSCPDVRFRRECLRAKDNGSIAIDWVVGDDRNLSPNSPTIILLPGLTGGSGDAYVRHMLMRVRKKGWRVVVFNSRGCGFSPVTTPQFYSASFLGDMNEVVAHVSSRFPEANLYAAGWSLGANILVNYMGQEADKCPLSGGVSLCNPFDLVLADEDFQTGFN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026254`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_026254`
Location	Chr05:123916760-123919322 (-)
Description	Similar to EMB8: Embryogenesis-associated protein EMB8
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026254` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006656 phosphatidylcholine biosynthetic process Biological Process GO:0046470 phosphatidylcholine metabolic process Biological Process GO:0051792 medium-chain fatty acid biosynthetic process Biological Process GO:0051793 medium-chain fatty acid catabolic process Biological Process GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0045335 phagocytic vesicle Cellular Component GO:0004623 A2-type glycerophospholipase activity Molecular Function GO:0008126 acetylesterase activity Molecular Function GO:0008970 glycerophospholipid phospholipase A1 activity Molecular Function GO:0034338 short-chain carboxylesterase activity Molecular Function GO:0047372 monoacylglycerol lipase activity Molecular Function
KEGG gene cross-reference	bta:539795 ddi:DDB_G0289723 hsa:171586 mmu:106861 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.904

Rank 1 · LXL04_026254 · OH-1004

Mitochondrion0.089

Rank 2 · LXL04_026254 · OH-1004

Cytoplasm0.044

Rank 3 · LXL04_026254 · OH-1004

Nucleus0.026

Rank 4 · LXL04_026254 · OH-1004

Cell membrane0.023

Rank 5 · LXL04_026254 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00561.27Abhydrolase_1137-376 aa

PF12146.16Hydrolase_4138-286 aa

PF12697.14Abhydrolase_6139-377 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026254	`PF00561.27`	Abhydrolase_1	137	376	1.6e-16	61.4
LXL04_026254	`PF12146.16`	Hydrolase_4	138	286	1.1e-08	35.4
LXL04_026254	`PF12697.14`	Abhydrolase_6	139	377	6.7e-07	30.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card