LXL04_026219 | RubberDandelionOmics

Gene overview

LXL04_026219

Reference: OH-1004 Chr: Chr05 Coordinates: 122932344-122933501 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

897 bp · LXL04_026219|LXL04_026219|OH1004|cDNA

ATGGAAGGTGGTTATGGACAAACGCCGCCTGTTTCAGCGCCGCCGACGCCTGGAACGCCCGGAGGTCCGTTGTTTACATCCATGCGAATCGACTCTCTGTCGTATGACCGGAAGTCAATGACCCGTTGCAAGTGTCTGCCGGTTGACGCTCCATCATTCGGTGCACCTCACACTTGCTTCACCGATTTCCCTGCTCCCGACATCTCTCTCACCCGAAAGTTGGGAGCTGAATTCGTCGGAACATTTATCTTAATATTCGC...

CDS

Download CDS FASTA

897 bp · LXL04_026219|LXL04_026219|OH1004|CDS

ATGGAAGGTGGTTATGGACAAACGCCGCCTGTTTCAGCGCCGCCGACGCCTGGAACGCCCGGAGGTCCGTTGTTTACATCCATGCGAATCGACTCTCTGTCGTATGACCGGAAGTCAATGACCCGTTGCAAGTGTCTGCCGGTTGACGCTCCATCATTCGGTGCACCTCACACTTGCTTCACCGATTTCCCTGCTCCCGACATCTCTCTCACCCGAAAGTTGGGAGCTGAATTCGTCGGAACATTTATCTTAATATTCGC...

Protein

Download Protein FASTA

298 aa · LXL04_026219|LXL04_026219|OH1004|PROTEIN

MEGGYGQTPPVSAPPTPGTPGGPLFTSMRIDSLSYDRKSMTRCKCLPVDAPSFGAPHTCFTDFPAPDISLTRKLGAEFVGTFILIFAATAGPIVNEKYSGSETLIGNAACAGLAVMIIILSTGHISGAHLNPSLTIAFAALRHFPWAQVPAYILAQVSASICASFALKGVFHPFMSGGVTVPSVTTGQAFALEFLITFNLLFVVTAVATDTRAVGELAGIAVGATVMLNILVAGKSSGASMNPVRTLGPAVAAGNYTVMW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026219`
TK1151 ID	TkA06G020830
OH-1004 ID	LXL04_026219
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026219

Location Chr05:122932344-122933501 (+)

Description Similar to NIP5-1: Probable aquaporin NIP5-1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10380`	Boric acid transporter.	No verified direct reference in this release
`At1g80760`	Transports glycerol, urea and formamide, in Xenopus laevis oocytes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0513200`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`Os08g0152000`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026219 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009749 response to glucose Biological Process

GO:0010036 response to boron-containing substance Biological Process

GO:0015700 arsenite transport Biological Process

GO:0046685 response to arsenic-containing substance Biological Process

GO:0046713 borate transport Biological Process

GO:0080029 cellular response to boron-containing substance levels Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0016328 lateral plasma membrane Cellular Component

GO:0015105 arsenite transmembrane transporter activity Molecular Function

GO:0015168 glycerol transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G80760

ath:AT4G10380

dosa:Os10g0513200

osa:107276042

zma:541885

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.713

Rank 1 · LXL04_026219 · OH-1004

Cytoplasm0.154

Rank 2 · LXL04_026219 · OH-1004

Endoplasmic reticulum0.108

Rank 3 · LXL04_026219 · OH-1004

Lysosome / Vacuole0.092

Rank 4 · LXL04_026219 · OH-1004

Golgi apparatus0.062

Rank 5 · LXL04_026219 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230.26MIP69-276 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026219	`PF00230.26`	MIP	69	276	4.1e-49	168.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SV84`	Arabidopsis thaliana	Probable aquaporin NIP5-1	81.884%	Swiss-Prot	strong database homology
`Q9SAI4`	Arabidopsis thaliana	Aquaporin NIP6-1	67.577%	Swiss-Prot	strong database homology
`Q0IWF3`	Oryza sativa subsp. japonica	Aquaporin NIP3-1	73.883%	Swiss-Prot	strong database homology
`Q7EYH7`	Oryza sativa subsp. japonica	Aquaporin NIP3-2	54.709%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card