LXL04_026162 | RubberDandelionOmics

Gene overview

LXL04_026162

Reference: OH-1004 Chr: Chr05 Coordinates: 122029397-122030484 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

438 bp · LXL04_026162|LXL04_026162|OH1004|cDNA

ATGCCAGTTCCTCTAGCTCCATATCCAACTCCTCCCGCACCTCTTACAACCCCTGCTAATGGATCGCAAAGCCAGTTAGTATGTTCAGGGTGTCGAAATCTTCTACTTTACCCTGTCGGAGCTACTTCAGTATGCTGCGCAGTTTGTAATGCCGTCACCTCTGTTCCTCCTCCTGGTACTGAAATGGCTCAGTTGGTTTGTGGAGGCTGCCATACATTGCTCATGTACATCCGTGGTGCGACAAGTGTACAGTGTTCTTG...

CDS

Download CDS FASTA

438 bp · LXL04_026162|LXL04_026162|OH1004|CDS

ATGCCAGTTCCTCTAGCTCCATATCCAACTCCTCCCGCACCTCTTACAACCCCTGCTAATGGATCGCAAAGCCAGTTAGTATGTTCAGGGTGTCGAAATCTTCTACTTTACCCTGTCGGAGCTACTTCAGTATGCTGCGCAGTTTGTAATGCCGTCACCTCTGTTCCTCCTCCTGGTACTGAAATGGCTCAGTTGGTTTGTGGAGGCTGCCATACATTGCTCATGTACATCCGTGGTGCGACAAGTGTACAGTGTTCTTG...

Protein

Download Protein FASTA

145 aa · LXL04_026162|LXL04_026162|OH1004|PROTEIN

MPVPLAPYPTPPAPLTTPANGSQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTSVPPPGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCGNCRMLLMYQYGARSVKCAVCQFITSVGASTSATEQKFTA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026162`
TK1151 ID	TkA06G023830
OH-1004 ID	LXL04_026162
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.200
Protein coverage (%)	TK1151 77.778 / OH-1004 91.724 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026162

Location Chr05:122029397-122030484 (-)

Description Similar to LOL1: Protein LOL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32540`	Positive regulator of reactive oxygen-induced cell death.	Antagonistic control of oxidative stress-induced cell death in Arabidopsis by two related, plant-specific zinc finger proteins.2003 · DOI: 10.1073/pnas.1130421100
`At4g20380`	Negative regulator of reactive oxygen-induced cell death, cold stress-induced cell death, pathogen-induced hypersensitive response (HR), basal disease resistance.	The Arabidopsis LSD1 gene plays an important role in the regulation of low temperature-dependent cell death.2010 · DOI: 10.1111/j.1469-8137.2010.03275.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0159500`	Negative regulator of programmed cell death and hypersensitive response (HR).	OsLSD1, a rice zinc finger protein, regulates programmed cell death and callus differentiation.2005 · DOI: 10.1094/mpmi-18-0375
`Os12g0611000`	Putative zinc finger that may be involved in programmed cell death and defense response.	No verified direct reference in this release
`Os03g0639600`	Putative zinc finger that may be involved in programmed cell death and defense response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026162 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000303 response to superoxide Biological Process

GO:0001666 response to hypoxia Biological Process

GO:0002240 response to molecule of oomycetes origin Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0010104 regulation of ethylene-activated signaling pathway Biological Process

GO:0010310 regulation of hydrogen peroxide metabolic process Biological Process

GO:0010602 regulation of 1-aminocyclopropane-1-carboxylate metabolic process Biological Process

GO:0010618 aerenchyma formation Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0034051 negative regulation of plant-type hypersensitive response Biological Process

KEGG gene cross-reference

ath:AT1G32540

ath:AT4G20380

dosa:Os03g0639600

dosa:Os08g0159500

dosa:Os12g0611000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.602

Rank 1 · LXL04_026162 · OH-1004

Cytoplasm0.497

Rank 2 · LXL04_026162 · OH-1004

Cell membrane0.078

Rank 3 · LXL04_026162 · OH-1004

Endoplasmic reticulum0.057

Rank 4 · LXL04_026162 · OH-1004

Mitochondrion0.056

Rank 5 · LXL04_026162 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06943.18zf-LSD128-52 aa

PF06943.18zf-LSD167-91 aa

PF06943.18zf-LSD1105-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026162	`PF06943.18`	zf-LSD1	28	52	1.6e-37	127.7
LXL04_026162	`PF06943.18`	zf-LSD1	67	91	1.6e-37	127.7
LXL04_026162	`PF06943.18`	zf-LSD1	105	129	1.6e-37	127.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZB1`	Arabidopsis thaliana	Protein LOL1	86.029%	Swiss-Prot	strong database homology
`P94077`	Arabidopsis thaliana	Protein LSD1	59.200%	Swiss-Prot	strong database homology
`Q0J7V9`	Oryza sativa subsp. japonica	Protein LSD1	85.915%	Swiss-Prot	strong database homology
`Q2QMB3`	Oryza sativa subsp. japonica	Protein LOL2	64.348%	Swiss-Prot	strong database homology
`Q6ASS2`	Oryza sativa subsp. japonica	Protein LOL3	61.864%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card