LXL04_026149 | RubberDandelionOmics

Gene overview

LXL04_026149

Reference: OH-1004 Chr: Chr05 Coordinates: 121854267-121854908 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

642 bp · LXL04_026149|LXL04_026149|OH1004|cDNA

ATGGAGAAAGGCGAAGCCTCCTCCACGCCGGAAGGAGACAAACCACCTTCTCCACCGCCGCAAACCATCACTAAAACGACGGGCCACCACCTGTCCGCCCCACCTGGTTTGACCAACGACGAGTTCAACGAGTTGAAACATTTTATAATCAACTTCCACACCTACCATCTCACATCATCCCAATGTTCCTCCCTACTCGCCCAACACATCCACGCGCCGGTCGACGTCGTTTGGTCAGTCGTCCGTCGATTCGACAAACC...

CDS

Download CDS FASTA

642 bp · LXL04_026149|LXL04_026149|OH1004|CDS

ATGGAGAAAGGCGAAGCCTCCTCCACGCCGGAAGGAGACAAACCACCTTCTCCACCGCCGCAAACCATCACTAAAACGACGGGCCACCACCTGTCCGCCCCACCTGGTTTGACCAACGACGAGTTCAACGAGTTGAAACATTTTATAATCAACTTCCACACCTACCATCTCACATCATCCCAATGTTCCTCCCTACTCGCCCAACACATCCACGCGCCGGTCGACGTCGTTTGGTCAGTCGTCCGTCGATTCGACAAACC...

Protein

Download Protein FASTA

213 aa · LXL04_026149|LXL04_026149|OH1004|PROTEIN

MEKGEASSTPEGDKPPSPPPQTITKTTGHHLSAPPGLTNDEFNELKHFIINFHTYHLTSSQCSSLLAQHIHAPVDVVWSVVRRFDKPQTYKHFIKSCTVSEGFTMTVGCTRDVNVISGLPAATSTERLDLLDDENHVLGFTIIGGEHRLRNYHAVTTVHDITRAVDSRPITVVLESYVVDVPEGNTEEDTRLFADTVVKLNLQKLASVTEAMA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026149`
TK1151 ID	TkA06G024500
OH-1004 ID	LXL04_026149
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026149

Location Chr05:121854267-121854908 (-)

Description Similar to PYR1: Abscisic acid receptor PYR1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17870`	May act as an abscisic acid receptor in ABA signaling.	The molecular basis of ABA-independent inhibition of PP2Cs by a subclass of PYL proteins.2011 · DOI: 10.1016/j.molcel.2011.05.011 The Expression of CARK1 or RCAR11 Driven by Synthetic Promoters Increases Drought Tolerance in Arabidopsis thaliana .2018 · DOI: 10.3390/ijms19071945
`At5g46790`	May act as an abscisic acid receptor in ABA signaling.	Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At2g26040`	Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition.	The molecular basis of ABA-independent inhibition of PP2Cs by a subclass of PYL proteins.2011 · DOI: 10.1016/j.molcel.2011.05.011
`At4g01026`	Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0573400`	May participate in ABA signaling and inhibit associated protein phosphatase activity.	Identification and characterization of ABA receptors in Oryza sativa.2014 · DOI: 10.1371/journal.pone.0095246 ABA Regulates Subcellular Redistribution of OsABI-LIKE2, a Negative Regulator in ABA Signaling, to Control Root Architecture and Drought Resistance in Oryza sativa.2015 · DOI: 10.1093/pcp/pcv154

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026149 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:1902584 positive regulation of response to water deprivation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0062049 protein phosphatase inhibitor complex Cellular Component

GO:0004864 protein phosphatase inhibitor activity Molecular Function

GO:0010427 abscisic acid binding Molecular Function

KEGG gene cross-reference

ath:AT2G26040

ath:AT4G01026

ath:AT4G17870

ath:AT5G46790

dosa:Os10g0573400

osa:4349472

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.655

Rank 1 · LXL04_026149 · OH-1004

Nucleus0.492

Rank 2 · LXL04_026149 · OH-1004

Cell membrane0.087

Rank 3 · LXL04_026149 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_026149 · OH-1004

Lysosome / Vacuole0.045

Rank 5 · LXL04_026149 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10604.16Polyketide_cyc268-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026149	`PF10604.16`	Polyketide_cyc2	68	208	9.8e-14	52.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O49686`	Arabidopsis thaliana	Abscisic acid receptor PYR1	70.556%	Swiss-Prot	strong database homology
`Q8VZS8`	Arabidopsis thaliana	Abscisic acid receptor PYL1	65.258%	Swiss-Prot	strong database homology
`O80992`	Arabidopsis thaliana	Abscisic acid receptor PYL2	54.023%	Swiss-Prot	strong database homology
`Q1ECF1`	Arabidopsis thaliana	Abscisic acid receptor PYL7	54.658%	Swiss-Prot	strong database homology
`Q7XBY6`	Oryza sativa subsp. japonica	Abscisic acid receptor PYL10	58.791%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card