LXL04_026079 | RubberDandelionOmics

Gene overview

LXL04_026079

Reference: OH-1004 Chr: Chr05 Coordinates: 120670231-120671883 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1653 bp · LXL04_026079|LXL04_026079|OH1004|cDNA

ATGGATAACGAAACCCAGATCAAGAAGAGAAAGCTTCAAACTGAAACTATGGAAGCTAATGGTGTGATTTTCGTAGTACCATTCTTTGGTCAAGGTCATCTCTTCCCAGCTATGGAGCTCTGCAAAAACATTTCAACTGATCATCATTACAGTGTCACACTCATCATCCCTTCTCATCTTTCTTCATCTATCCCATCCACGTTTTCTGACAACTCCCCTTTCATTCATGTTACTGAGATCTCCGTCGCCGCTTCGCCTAC...

CDS

Download CDS FASTA

1653 bp · LXL04_026079|LXL04_026079|OH1004|CDS

ATGGATAACGAAACCCAGATCAAGAAGAGAAAGCTTCAAACTGAAACTATGGAAGCTAATGGTGTGATTTTCGTAGTACCATTCTTTGGTCAAGGTCATCTCTTCCCAGCTATGGAGCTCTGCAAAAACATTTCAACTGATCATCATTACAGTGTCACACTCATCATCCCTTCTCATCTTTCTTCATCTATCCCATCCACGTTTTCTGACAACTCCCCTTTCATTCATGTTACTGAGATCTCCGTCGCCGCTTCGCCTAC...

Protein

Download Protein FASTA

550 aa · LXL04_026079|LXL04_026079|OH1004|PROTEIN

MDNETQIKKRKLQTETMEANGVIFVVPFFGQGHLFPAMELCKNISTDHHYSVTLIIPSHLSSSIPSTFSDNSPFIHVTEISVAASPTPEIADEPGSEKEDRPSGPKGNPLQEQNLQMGKGIKSFLSTRSGVRPTCVVVDNMMSWCKEIFADLGIPVVSFSTSGATASAMGHGMWKAEVGNMKPGEIREIPGLPKEMFVTFADLSRGPRRRPQRRNRPPGDSANQDGSTGPPHRMRSGPRHGPRGGVGGGSAGPGDKPRWV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_026079`
TK1151 ID	TkA06G028260
OH-1004 ID	LXL04_026079
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	89.700
Protein coverage (%)	TK1151 100.000 / OH-1004 97.091 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_026079

Location Chr05:120670231-120671883 (-)

Description Similar to UGT73B1: UDP-glycosyltransferase 73B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g34138`	Possesses low quercetin 3-O-glucosyltransferase and 7-O-glucosyltransferase activities in vitro.	No verified direct reference in this release
`At4g34135`	Catalyzes the glycosylation of flavonoids from UDP-glucose.	No verified direct reference in this release
`At2g36780`	UDP-glycosyltransferase 73C3.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026079 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0009718 anthocyanin-containing compound biosynthetic process Biological Process

GO:0016104 triterpenoid biosynthetic process Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0051555 flavonol biosynthetic process Biological Process

GO:0051707 response to other organism Biological Process

GO:0009507 chloroplast Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0033836 flavonol 7-O-beta-glucosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0047213 anthocyanidin 3-O-glucosyltransferase activity Molecular Function

GO:0047893 flavonol 3-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G36780

ath:AT4G34135

ath:AT4G34138

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.674

Rank 1 · LXL04_026079 · OH-1004

Nucleus0.327

Rank 2 · LXL04_026079 · OH-1004

Endoplasmic reticulum0.096

Rank 3 · LXL04_026079 · OH-1004

Cell membrane0.082

Rank 4 · LXL04_026079 · OH-1004

Plastid0.058

Rank 5 · LXL04_026079 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201.25UDPGT328-523 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_026079	`PF00201.25`	UDPGT	328	523	5e-21	75.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZE9`	Arabidopsis thaliana	UDP-glycosyltransferase 73B1	24.754%	Swiss-Prot	weak database homology
`Q94C57`	Arabidopsis thaliana	UDP-glucosyl transferase 73B2	25.962%	Swiss-Prot	weak database homology
`Q9ZQ96`	Arabidopsis thaliana	UDP-glycosyltransferase 73C3	27.725%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card