LXL04_025941 | RubberDandelionOmics

Gene overview

LXL04_025941

Reference: OH-1004 Chr: Chr05 Coordinates: 118821583-118822795 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

675 bp · LXL04_025941|LXL04_025941|OH1004|cDNA

ATGGATATCGATGAAAATGTTGAAGATGGTTCAAGAAGAGTACAAGTGCGGTTCATTACGAAGCTTAAACTGCCGTTCAAAGCTCCGACAACCTCCATTGCTCTCCCTTCTAATCTTACAAGGATGGGTCTTTCAGCCGTCGTTAATAACATGCTTCAATCAGTCTCCGTATCATGTAACCTTCATTTTTGTTTACGTAATGATGATTGGAAACCTGAACCATTCGATTTCCTTATCGATGACTTTCTTCTTGCAAGAGG...

CDS

Download CDS FASTA

675 bp · LXL04_025941|LXL04_025941|OH1004|CDS

ATGGATATCGATGAAAATGTTGAAGATGGTTCAAGAAGAGTACAAGTGCGGTTCATTACGAAGCTTAAACTGCCGTTCAAAGCTCCGACAACCTCCATTGCTCTCCCTTCTAATCTTACAAGGATGGGTCTTTCAGCCGTCGTTAATAACATGCTTCAATCAGTCTCCGTATCATGTAACCTTCATTTTTGTTTACGTAATGATGATTGGAAACCTGAACCATTCGATTTCCTTATCGATGACTTTCTTCTTGCAAGAGG...

Protein

Download Protein FASTA

224 aa · LXL04_025941|LXL04_025941|OH1004|PROTEIN

MDIDENVEDGSRRVQVRFITKLKLPFKAPTTSIALPSNLTRMGLSAVVNNMLQSVSVSCNLHFCLRNDDWKPEPFDFLIDDFLLARGISAETTIEIEYIKAVAPRKEEDPSLHDDWVNADMERRKSLYTCFRGSQWCNYIGSCCKTKRYDIFLPNSSVQSLASQPNGNMICSGSWDRRINLWETECNKGDFVSIKKRKKGSKEEESQSDYFRLFQVFCTIFYVG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025941`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025941

Location Chr05:118821583-118822795 (-)

Description Similar to WDR12: Ribosome biogenesis protein WDR12 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15550`	Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0600400`	Required for maturation of ribosomal RNAs and formation of the large ribosomal subunit.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025941 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000466 maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0051276 chromosome organization Biological Process

GO:0110136 protein-RNA complex remodeling Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0030687 preribosome, large subunit precursor Cellular Component

GO:0070545 PeBoW complex Cellular Component

GO:0080008 Cul4-RING E3 ubiquitin ligase complex Cellular Component

GO:0043021 ribonucleoprotein complex binding Molecular Function

KEGG gene cross-reference

ang:An04g02000

ath:AT5G15550

dosa:Os07g0600400

nfi:NFIA_108560

osa:4343819

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.672

Rank 1 · LXL04_025941 · OH-1004

Cytoplasm0.322

Rank 2 · LXL04_025941 · OH-1004

Cell membrane0.056

Rank 3 · LXL04_025941 · OH-1004

Endoplasmic reticulum0.051

Rank 4 · LXL04_025941 · OH-1004

Mitochondrion0.037

Rank 5 · LXL04_025941 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08154.19NLE14-83 aa

PF00400.39WD40156-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025941	`PF08154.19`	NLE	14	83	3.2e-14	53.8
LXL04_025941	`PF00400.39`	WD40	156	182	4.2e-06	27.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LF27`	Arabidopsis thaliana	Ribosome biogenesis protein WDR12 homolog	41.241%	Swiss-Prot	moderate database homology
`Q8H594`	Oryza sativa subsp. japonica	Ribosome biogenesis protein WDR12 homolog	36.396%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card