LXL04_025924 | RubberDandelionOmics

Gene overview

LXL04_025924

Reference: OH-1004 Chr: Chr05 Coordinates: 118617474-118620335 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1539 bp · LXL04_025924|LXL04_025924|OH1004|cDNA

ATGGCCAACCTAGAGAACCAAAATCTCATCGACTCAACTGACCATTCTCCGGacaccaccaccgccgccgccatCCAGCACCACCCACAACCACCACCATCCATCACCTCAAAACAACTCAACCCAATAGCATCCCTCATCCTCCAACCATTCCAATGGCTAAAAATGCTATCTTCAGAACTCAATCCATCATTCATCCTCGGAATCTTCGTCGTGTACGGCCTCAGCCACGGCTTCTCAGCCTCCTTCTTCAAAGTCGT...

CDS

Download CDS FASTA

1539 bp · LXL04_025924|LXL04_025924|OH1004|CDS

ATGGCCAACCTAGAGAACCAAAATCTCATCGACTCAACTGACCATTCTCCGGACACCACCACCGCCGCCGCCATCCAGCACCACCCACAACCACCACCATCCATCACCTCAAAACAACTCAACCCAATAGCATCCCTCATCCTCCAACCATTCCAATGGCTAAAAATGCTATCTTCAGAACTCAATCCATCATTCATCCTCGGAATCTTCGTCGTGTACGGCCTCAGCCACGGCTTCTCAGCCTCCTTCTTCAAAGTCGT...

Protein

Download Protein FASTA

512 aa · LXL04_025924|LXL04_025924|OH1004|PROTEIN

MANLENQNLIDSTDHSPDTTTAAAIQHHPQPPPSITSKQLNPIASLILQPFQWLKMLSSELNPSFILGIFVVYGLSHGFSASFFKVVTDYYWKDVQNVQPSKVQVFIGLYHIPWVMKPIWGLMTDVFPVRGYKRRPYFILAGVVGVMAAITVAEGGARVGVGAALWCLIAIAAGMAMADVTIDACIARNSIEMKALAPDMQSLCGVCSSAGALIGYSTSGFFVHHLGPQIALGLLAIPAASQIILGFVIYEKKTSDDSSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025924`
TK1151 ID	TkA06G036340
OH-1004 ID	LXL04_025924
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.700
Protein coverage (%)	TK1151 100.000 / OH-1004 89.258 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025924

Location Chr05:118617474-118620335 (+)

Description Similar to At5g10820: Probable folate-biopterin transporter 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10820`	Could mediate folate transport.	No verified direct reference in this release
`At1g79710`	Could mediate folate transport.	No verified direct reference in this release
`At5g25050`	Could mediate folate transport.	No verified direct reference in this release
`At5g25040`	Could mediate folate transport.	No verified direct reference in this release
`At5g54860`	Could mediate folate transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025924 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0098838 folate transmembrane transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

GO:0008517 folic acid transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G79710

ath:AT5G10820

ath:AT5G25040

ath:AT5G25050

ath:AT5G54860

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.436

Rank 1 · LXL04_025924 · OH-1004

Cell membrane0.220

Rank 2 · LXL04_025924 · OH-1004

Endoplasmic reticulum0.154

Rank 3 · LXL04_025924 · OH-1004

Golgi apparatus0.107

Rank 4 · LXL04_025924 · OH-1004

Cytoplasm0.091

Rank 5 · LXL04_025924 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03092.23BT178-490 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025924	`PF03092.23`	BT1	78	490	7.6e-108	361.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LEV7`	Arabidopsis thaliana	Probable folate-biopterin transporter 6	60.288%	Swiss-Prot	strong database homology
`Q9SQN2`	Arabidopsis thaliana	Probable folate-biopterin transporter 3	48.546%	Swiss-Prot	moderate database homology
`Q5FV41`	Arabidopsis thaliana	Probable folate-biopterin transporter 2	46.751%	Swiss-Prot	moderate database homology
`F4KIL8`	Arabidopsis thaliana	Probable folate-biopterin transporter 5	44.211%	Swiss-Prot	moderate database homology
`Q8RWQ5`	Arabidopsis thaliana	Probable folate-biopterin transporter 4	25.205%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card