LXL04_025923 | RubberDandelionOmics

Gene overview

LXL04_025923

Reference: OH-1004 Chr: Chr05 Coordinates: 118614075-118616949 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2322 bp · LXL04_025923|LXL04_025923|OH1004|cDNA

ATGGCGTTGTTGAAAGAGTTGGCGCACCTCAAAATCTCATTAGATGTCGTCAAGTTAGCCACCAACAACTTTGGTGCAGAGAATTTTGTAGGAGTCGGTGGTTTTGGCAAGGTTTACAAAGGAGAGATAATTTTTCCCGACGGGCTAACCAAAACCGTCGCGATAAAGAGGTTAGACAGAAGACATGGACAAGGTGAACACGAGTTTCTCATGGAGATAATGATGCTCTCACGTTACCGACACAAAAACCTAGTCTCTCT...

CDS

Download CDS FASTA

2322 bp · LXL04_025923|LXL04_025923|OH1004|CDS

ATGGCGTTGTTGAAAGAGTTGGCGCACCTCAAAATCTCATTAGATGTCGTCAAGTTAGCCACCAACAACTTTGGTGCAGAGAATTTTGTAGGAGTCGGTGGTTTTGGCAAGGTTTACAAAGGAGAGATAATTTTTCCCGACGGGCTAACCAAAACCGTCGCGATAAAGAGGTTAGACAGAAGACATGGACAAGGTGAACACGAGTTTCTCATGGAGATAATGATGCTCTCACGTTACCGACACAAAAACCTAGTCTCTCT...

Protein

Download Protein FASTA

773 aa · LXL04_025923|LXL04_025923|OH1004|PROTEIN

MALLKELAHLKISLDVVKLATNNFGAENFVGVGGFGKVYKGEIIFPDGLTKTVAIKRLDRRHGQGEHEFLMEIMMLSRYRHKNLVSLLGFCDEGEEKILIYEYLFNGSLEKYLSSNSLTWAQRLKICIGAARGLEYLHNPFGTQQRVLHRDVKSANVLLDELWETKIADFGLSKIGPANQEFTFLVSNAVGTFGYCDPLYAETNILTKESDVYSFGAVLFEVLCGRFCVGKPDDKHRLLTKLAQQSYEQGTLDDIIFHGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025923`
TK1151 ID	TkA06G036330
OH-1004 ID	LXL04_025923
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.800
Protein coverage (%)	TK1151 97.804 / OH-1004 74.903 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025923

Location Chr05:118614075-118616949 (-)

Description Similar to HERK1: Receptor-like protein kinase HERK 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release
`At3g51550`	May regulate MLO7 polarization in female gametophyte synergid cells to control pollen tube growth and male gamete delivery during fertilization.	FERONIA receptor-like kinase regulates RHO GTPase signaling of root hair development.2010 · DOI: 10.1073/pnas.1005366107
`At5g28680`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release
`At3g04690`	Receptor-like protein kinase that controls pollen tube behavior by directing rupture at proper timing to release the sperm cell.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025923 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009723 response to ethylene Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0030308 negative regulation of cell growth Biological Process

KEGG gene cross-reference

ath:AT3G04690

ath:AT3G46290

ath:AT3G51550

ath:AT5G28680

ath:AT5G59700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.528

Rank 1 · LXL04_025923 · OH-1004

Nucleus0.346

Rank 2 · LXL04_025923 · OH-1004

Cell membrane0.258

Rank 3 · LXL04_025923 · OH-1004

Endoplasmic reticulum0.066

Rank 4 · LXL04_025923 · OH-1004

Lysosome / Vacuole0.051

Rank 5 · LXL04_025923 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase28-295 aa

PF07714.24PK_Tyr_Ser-Thr29-297 aa

PF14299.14PP2361-490 aa

PF14299.14PP2609-772 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025923	`PF00069.32`	Pkinase	28	295	4e-40	138.6
LXL04_025923	`PF07714.24`	PK_Tyr_Ser-Thr	29	297	1.3e-42	146.7
LXL04_025923	`PF14299.14`	PP2	361	490	9.4e-36	123.7
LXL04_025923	`PF14299.14`	PP2	609	772	9.4e-36	123.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	49.838%	Swiss-Prot	weak database homology
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	46.749%	Swiss-Prot	weak database homology
`Q9SCZ4`	Arabidopsis thaliana	Receptor-like protein kinase FERONIA	47.279%	Swiss-Prot	weak database homology
`Q3E8W4`	Arabidopsis thaliana	Receptor-like protein kinase ANXUR2	48.658%	Swiss-Prot	weak database homology
`Q9SR05`	Arabidopsis thaliana	Receptor-like protein kinase ANXUR1	47.315%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card