LXL04_025910 | RubberDandelionOmics

Gene overview

LXL04_025910

Reference: OH-1004 Chr: Chr05 Coordinates: 118469887-118471046 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1014 bp · LXL04_025910|LXL04_025910|OH1004|cDNA

ATGGACAACCAGTTCAATGTGGGAGATATAGTTTGGGCAAAACTTCATGGCCATCCATGGTGGCCTAGCATCATATACAATGAAGCCCTAACAACCCCACAAGTTCAAGAAACAAAAAAAGAAGGTTTTTTTCTCGTTTCATTTTTCGGCGATAATTCCTATATATGGCTAAATCCCAAAAATCTCCTCCATTTTCAATCCAACTTTAGATCCCATTCAAATCGATCCAATTCCCCATTATTCATAAAAGCTGTCAATGA...

CDS

Download CDS FASTA

1014 bp · LXL04_025910|LXL04_025910|OH1004|CDS

ATGGACAACCAGTTCAATGTGGGAGATATAGTTTGGGCAAAACTTCATGGCCATCCATGGTGGCCTAGCATCATATACAATGAAGCCCTAACAACCCCACAAGTTCAAGAAACAAAAAAAGAAGGTTTTTTTCTCGTTTCATTTTTCGGCGATAATTCCTATATATGGCTAAATCCCAAAAATCTCCTCCATTTTCAATCCAACTTTAGATCCCATTCAAATCGATCCAATTCCCCATTATTCATAAAAGCTGTCAATGA...

Protein

Download Protein FASTA

337 aa · LXL04_025910|LXL04_025910|OH1004|PROTEIN

MDNQFNVGDIVWAKLHGHPWWPSIIYNEALTTPQVQETKKEGFFLVSFFGDNSYIWLNPKNLLHFQSNFRSHSNRSNSPLFIKAVNEAVYETNHRAAIGLTCPCLYYSSYRPSQVEGFLEVDLNGYSSGGVYSVKQINGFRQEFEPVQTLSFVQILALDSINVNQDLNFSKEVARVLAFRKAKYAEVDEPYFVAFKSDIIQAPSETKDRKKATVKYQNKKKRYLATHNVKRNELDDCNIKSSEDHDFYKKRHVNLEVVKN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025910`
TK1151 ID	TkA06G035760
OH-1004 ID	LXL04_025910
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025910

Location Chr05:118469887-118471046 (-)

Description Similar to pwwp2a: PWWP domain-containing protein 2A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05430`	May influence gene expression by regulating the function of the PRC2 complex and modulating H3K27me3 level.	No verified direct reference in this release
`At5g27650`	Together with PDP2, PDP3 and PDP6, interacts with MSI4/FVE and MSI5 to suppress FLC, MAF4 and MAF5 expression by regulating the function of the PRC2 complex and modulating H3K27me3 level, thereby promoting flowering.	No verified direct reference in this release
`At3g09670`	Together with PDP1, PDP3 and PDP6, interacts with MSI4/FVE and MSI5 to suppress FLC, MAF4 and MAF5 expression by regulating the function of the PRC2 complex and modulating H3K27me3 level, thereby promoting flowering.	No verified direct reference in this release
`At5g02950`	May influence gene expression by regulating the function of the PRC2 complex and modulating H3K27me3 level.	No verified direct reference in this release
`At5g40340`	Together with PDP1, PDP2 and PDP6, interacts with MSI4/FVE and MSI5 to suppress FLC, MAF4 and MAF5 expression by regulating the function of the PRC2 complex and modulating H3K27me3 level, thereby promoting flowering.	Arabidopsis PWWP domain proteins mediate H3K27 trimethylation on FLC and regulate flowering time.2018 · DOI: 10.1111/jipb.12630

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025910 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0035098 ESC/E(Z) complex Cellular Component

KEGG gene cross-reference

ath:AT3G05430

ath:AT3G09670

ath:AT5G02950

ath:AT5G27650

ath:AT5G40340

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.959

Rank 1 · LXL04_025910 · OH-1004

Cytoplasm0.097

Rank 2 · LXL04_025910 · OH-1004

Cell membrane0.022

Rank 3 · LXL04_025910 · OH-1004

Endoplasmic reticulum0.011

Rank 4 · LXL04_025910 · OH-1004

Plastid0.008

Rank 5 · LXL04_025910 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00855.24PWWP8-88 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025910	`PF00855.24`	PWWP	8	88	3.3e-19	69.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MA56`	Arabidopsis thaliana	PWWP domain-containing protein 4	44.615%	Swiss-Prot	moderate database homology
`F4K4D6`	Arabidopsis thaliana	PWWP domain-containing protein 1	44.792%	Swiss-Prot	moderate database homology
`Q9SF36`	Arabidopsis thaliana	PWWP domain-containing protein 2	28.283%	Swiss-Prot	weak database homology
`Q9LYZ0`	Arabidopsis thaliana	PWWP domain-containing protein 5	29.545%	Swiss-Prot	weak database homology
`Q9FNE4`	Arabidopsis thaliana	PWWP domain-containing protein 3	38.000%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card