LXL04_025895 | RubberDandelionOmics

Gene overview

LXL04_025895

Reference: OH-1004 Chr: Chr05 Coordinates: 118288426-118293684 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2241 bp · LXL04_025895|LXL04_025895|OH1004|cDNA

ATGCCTTTTCTCAACTTCTCAACTGACTATTTTCCTACTTTACCTAAATTTGACAAATTCGTGAAACATGTTCTGTCTCGCCGCAACCATCAAGTAGAAGTGTCTTCATTGAAGCTACGCTTTCGTGGAGCTTATAATCAGGGTTTTCTGAAAAAGATTGCAAAGTATGCCTTGTCTCACAATGTTCAAGAATTAACTCTCGTTAGTTTGACCTTTAGCCACCACTCTTACCCTCCTTGCCTATTTAGCTCTCAGTCTCT...

CDS

Download CDS FASTA

2241 bp · LXL04_025895|LXL04_025895|OH1004|CDS

ATGCCTTTTCTCAACTTCTCAACTGACTATTTTCCTACTTTACCTAAATTTGACAAATTCGTGAAACATGTTCTGTCTCGCCGCAACCATCAAGTAGAAGTGTCTTCATTGAAGCTACGCTTTCGTGGAGCTTATAATCAGGGTTTTCTGAAAAAGATTGCAAAGTATGCCTTGTCTCACAATGTTCAAGAATTAACTCTCGTTAGTTTGACCTTTAGCCACCACTCTTACCCTCCTTGCCTATTTAGCTCTCAGTCTCT...

Protein

Download Protein FASTA

746 aa · LXL04_025895|LXL04_025895|OH1004|PROTEIN

MPFLNFSTDYFPTLPKFDKFVKHVLSRRNHQVEVSSLKLRFRGAYNQGFLKKIAKYALSHNVQELTLVSLTFSHHSYPPCLFSSQSLKHFTLTCGYRYYDITQTALDFPALTTLNLSDLTLSGDLFSKCVNLKNLTLERFHGMDREEVFNIITPRLSNLTLIHGNHVKSVNVIAPQLENLTIIRCSIDNLNAPPGISSFCYTHLSTYSGVLQFCNDRFYSLNKVTICLVKIYTYDTYTEEFASKSINMLQKLQSAKYLTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025895`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025895

Location Chr05:118288426-118293684 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51530`	F-box/FBD/LRR-repeat protein At3g51530.	No verified direct reference in this release
`At4g03220`	Putative F-box/FBD/LRR-repeat protein At4g03220.	No verified direct reference in this release
`At1g78760`	Putative F-box/FBD/LRR-repeat protein At1g78760.	No verified direct reference in this release
`At3g26922`	F-box/LRR-repeat protein At3g26922.	No verified direct reference in this release
`At5g27750`	FBD-associated F-box protein At5g27750.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025895 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G78760

ath:AT3G26922

ath:AT3G51530

ath:AT4G03220

ath:AT5G27750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.608

Rank 1 · LXL04_025895 · OH-1004

Cytoplasm0.441

Rank 2 · LXL04_025895 · OH-1004

Cell membrane0.059

Rank 3 · LXL04_025895 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_025895 · OH-1004

Mitochondrion0.031

Rank 5 · LXL04_025895 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24758.2LRR_At5g5637058-185 aa

PF00646.39F-box351-389 aa

PF24758.2LRR_At5g56370446-571 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025895	`PF24758.2`	LRR_At5g56370	58	185	9.1e-20	72.0
LXL04_025895	`PF00646.39`	F-box	351	389	5.6e-06	26.8
LXL04_025895	`PF24758.2`	LRR_At5g56370	446	571	9.1e-20	72.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q501E9`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At3g51530	33.051%	Swiss-Prot	weak database homology
`Q9ZR09`	Arabidopsis thaliana	Putative F-box/FBD/LRR-repeat protein At4g03220	31.556%	Swiss-Prot	weak database homology
`Q9ZV94`	Arabidopsis thaliana	Putative F-box/FBD/LRR-repeat protein At1g78760	27.419%	Swiss-Prot	weak database homology
`Q9LJF8`	Arabidopsis thaliana	F-box/LRR-repeat protein At3g26922	30.769%	Swiss-Prot	weak database homology
`Q0V7P8`	Arabidopsis thaliana	FBD-associated F-box protein At5g27750	28.352%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card