LXL04_025834 | RubberDandelionOmics

Gene overview

LXL04_025834

Reference: OH-1004 Chr: Chr05 Coordinates: 117428688-117432289 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1893 bp · LXL04_025834|LXL04_025834|OH1004|cDNA

ATGGAGAAGAGATTatgtgtttttgagatattgCGGTTTGGGGTTTTATGTCTTGTAACATGGCTGAGTGTCGCATATGCAACTCTTTCTCCTTCTGGTGTCAATTATGAAGTTGTAGCTTTAATGGCGATAAAAGGCGATCTAAAGGACCCACGCAATATAATGGACAATTGGGATTTATCTTCTGTGGATCCTTGTAGTTGGCGGATGGTTACTTGTAATTCCGATCGCTCTGTTTCAGCTTTAGGGCTACCTAGTCA...

CDS

Download CDS FASTA

1893 bp · LXL04_025834|LXL04_025834|OH1004|CDS

ATGGAGAAGAGATTATGTGTTTTTGAGATATTGCGGTTTGGGGTTTTATGTCTTGTAACATGGCTGAGTGTCGCATATGCAACTCTTTCTCCTTCTGGTGTCAATTATGAAGTTGTAGCTTTAATGGCGATAAAAGGCGATCTAAAGGACCCACGCAATATAATGGACAATTGGGATTTATCTTCTGTGGATCCTTGTAGTTGGCGGATGGTTACTTGTAATTCCGATCGCTCTGTTTCAGCTTTAGGGCTACCTAGTCA...

Protein

Download Protein FASTA

630 aa · LXL04_025834|LXL04_025834|OH1004|PROTEIN

MEKRLCVFEILRFGVLCLVTWLSVAYATLSPSGVNYEVVALMAIKGDLKDPRNIMDNWDLSSVDPCSWRMVTCNSDRSVSALGLPSQNLSGTLSSAIGNLSNLQSVTLQNNAIIGPISDAIGKLQKLQTLDLSGNLFSGQLPSSLGDLKNLNFLRLNNNSLSGPVPESLSQVEGLTLVDVSYNNLTGPLPKLSARTFKITGNPLLCGQNSVNNCSNIYPEPLSFPPDDFTDQPSTNDKTHHLAIALGTSLSGIFVIILIV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025834`
TK1151 ID	TkA06G040460
OH-1004 ID	LXL04_025834
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025834

Location Chr05:117428688-117432289 (-)

Description Similar to NIK3: Protein NSP-INTERACTING KINASE 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60800`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release
`At5g16000`	May act as a receptor kinase regulating meristem homeostasis and protophloem differentiation.	Regulated nuclear trafficking of rpL10A mediated by NIK1 represents a defense strategy of plant cells against virus.2008 · DOI: 10.1371/journal.ppat.1000247 NIK1-mediated translation suppression functions as a plant antiviral immunity mechanism.2015 · DOI: 10.1038/nature14171 CLERK is a novel receptor kinase required for sensing of root-active CLE peptides in Arabidopsis .2018 · DOI: 10.1242/dev.162354
`At3g25560`	Receptor kinase acting, redundantly with other CIKs (e.g. CIK1, CIK2, CIK3, CIK5 and CIK6), as a coreceptor of CLV1, CLV2/CRN and RPK2, and required for CLAVATA-family peptides (e.g. CLV3, CLE25, CLE26 and CLE45) signaling through phosphorylation; this signaling regulates protophloem differentiation and the maintenance of shoot apical meristem (SAM) and root apical meristem (RAM) homeostasis, and acts down-stream of BRX and OPS.	No verified direct reference in this release
`At2g23950`	May act as a receptor kinase regulating meristem homeostasis and protophloem differentiation.	CLERK is a novel receptor kinase required for sensing of root-active CLE peptides in Arabidopsis .2018 · DOI: 10.1242/dev.162354 A CLE-BAM-CIK signalling module controls root protophloem differentiation in Arabidopsis.2022 · DOI: 10.1111/nph.17791

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0274500`	LRR receptor kinase that may be involved in defense response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025834 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0007639 homeostasis of number of meristem cells Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010088 phloem development Biological Process

GO:0034504 protein localization to nucleus Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0040015 negative regulation of multicellular organism growth Biological Process

GO:0048638 regulation of developmental growth Biological Process

GO:0048653 anther development Biological Process

GO:0051607 defense response to virus Biological Process

GO:0140374 antiviral innate immune response Biological Process

KEGG gene cross-reference

ath:AT1G60800

ath:AT2G23950

ath:AT3G25560

ath:AT5G16000

dosa:Os06g0274500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.882

Rank 1 · LXL04_025834 · OH-1004

Endoplasmic reticulum0.075

Rank 2 · LXL04_025834 · OH-1004

Cytoplasm0.071

Rank 3 · LXL04_025834 · OH-1004

Nucleus0.043

Rank 4 · LXL04_025834 · OH-1004

Lysosome / Vacuole0.024

Rank 5 · LXL04_025834 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_235-74 aa

PF13855.13LRR_878-136 aa

PF23598.2LRR_1494-181 aa

PF00069.32Pkinase308-578 aa

PF07714.24PK_Tyr_Ser-Thr310-580 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025834	`PF08263.18`	LRRNT_2	35	74	1.2e-11	45.4
LXL04_025834	`PF13855.13`	LRR_8	78	136	1.6e-08	34.9
LXL04_025834	`PF23598.2`	LRR_14	94	181	1e-09	38.3
LXL04_025834	`PF00069.32`	Pkinase	308	578	1.1e-40	140.4
LXL04_025834	`PF07714.24`	PK_Tyr_Ser-Thr	310	580	1.4e-40	140.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZS4`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 1	71.315%	Swiss-Prot	strong database homology
`Q9LFS4`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 5	61.465%	Swiss-Prot	strong database homology
`Q8RY65`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 6	61.803%	Swiss-Prot	strong database homology
`Q0WVM4`	Arabidopsis thaliana	Protein CLAVATA3 INSENSITIVE RECEPTOR KINASE 2	56.563%	Swiss-Prot	strong database homology
`Q9FP13`	Oryza sativa subsp. japonica	LRR receptor kinase SERL2	57.929%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card