LXL04_025805 | RubberDandelionOmics

Gene overview

LXL04_025805

Reference: OH-1004 Chr: Chr05 Coordinates: 117045595-117046257 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

663 bp · LXL04_025805|LXL04_025805|OH1004|cDNA

ATGAACTCCGCCTCCACCTCCGCCAGCGTCTTCAGACCACCGACATGCTCTATTCTTCCACCACAACCGTCAATTTCTTCGAATTCTAACCTTTCACGCATCCAATACAAACGAGCCAAAACAAATCCACGCTCCATCTCCACCATAGCACTACAAATCTCCCATCCAAAACACCTAACACCACCAGACCCTCCGAATTTCTCGACGTTACCCACCGTCTCGGAGAAGCTCGAGACTCTCGTTTCCGAATTCAGATCCTT...

CDS

Download CDS FASTA

663 bp · LXL04_025805|LXL04_025805|OH1004|CDS

ATGAACTCCGCCTCCACCTCCGCCAGCGTCTTCAGACCACCGACATGCTCTATTCTTCCACCACAACCGTCAATTTCTTCGAATTCTAACCTTTCACGCATCCAATACAAACGAGCCAAAACAAATCCACGCTCCATCTCCACCATAGCACTACAAATCTCCCATCCAAAACACCTAACACCACCAGACCCTCCGAATTTCTCGACGTTACCCACCGTCTCGGAGAAGCTCGAGACTCTCGTTTCCGAATTCAGATCCTT...

Protein

Download Protein FASTA

220 aa · LXL04_025805|LXL04_025805|OH1004|PROTEIN

MNSASTSASVFRPPTCSILPPQPSISSNSNLSRIQYKRAKTNPRSISTIALQISHPKHLTPPDPPNFSTLPTVSEKLETLVSEFRSLPEPIDRVKRLLHYASLLPEFEESGRVESNRVTGCTAQVWLEVVMDGEGRMRFRVDSDSEITKGFCYCLIWLLDGAAAGEVVDFRIDDLGEMNVGILPIRASSRVNTWHNVLLGMQRRTKALIMESDNSLPLLQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025805`
TK1151 ID	TkA03G118940
OH-1004 ID	LXL04_025805
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025805

Location Chr05:117045595-117046257 (+)

Description Similar to SUFE2: SufE-like protein 2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67810`	Participates in cysteine desulfurization mediated by NFS2.	Characterization of Arabidopsis thaliana SufE2 and SufE3: functions in chloroplast iron-sulfur cluster assembly and Nad synthesis.2007 · DOI: 10.1074/jbc.m701428200
`At5g50210`	Catalyzes the condensation of iminoaspartate with dihydroxyacetone phosphate to form quinolinate.	Characterization of Arabidopsis thaliana SufE2 and SufE3: functions in chloroplast iron-sulfur cluster assembly and Nad synthesis.2007 · DOI: 10.1074/jbc.m701428200 The Arabidopsis onset of leaf death5 mutation of quinolinate synthase affects nicotinamide adenine dinucleotide biosynthesis and causes early ageing.2008 · DOI: 10.1105/tpc.107.056341

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0290150`	Catalyzes the condensation of iminoaspartate with dihydroxyacetone phosphate to form quinolinate.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025805 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009060 aerobic respiration Biological Process

GO:0009435 NAD+ biosynthetic process Biological Process

GO:0009820 alkaloid metabolic process Biological Process

GO:0016226 iron-sulfur cluster assembly Biological Process

GO:0034628 'de novo' NAD+ biosynthetic process from L-aspartate Biological Process

GO:0042179 nicotine biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:1990228 sulfurtransferase complex Cellular Component

GO:0008047 enzyme activator activity Molecular Function

GO:0008987 quinolinate synthetase A activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G67810

ath:AT5G50210

nta:107813484

nta:107817199

osa:107275865

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.947

Rank 1 · LXL04_025805 · OH-1004

Mitochondrion0.062

Rank 2 · LXL04_025805 · OH-1004

Nucleus0.049

Rank 3 · LXL04_025805 · OH-1004

Cytoplasm0.040

Rank 4 · LXL04_025805 · OH-1004

Peroxisome0.016

Rank 5 · LXL04_025805 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02657.22SufE79-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025805	`PF02657.22`	SufE	79	204	4.2e-29	101.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FXE3`	Arabidopsis thaliana	SufE-like protein 2, chloroplastic	47.222%	Swiss-Prot	moderate database homology
`Q9FGS4`	Arabidopsis thaliana	Quinolinate synthase, chloroplastic	53.020%	Swiss-Prot	moderate database homology
`Q2QTL0`	Oryza sativa subsp. japonica	Quinolinate synthase, chloroplastic	49.231%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card