LXL04_025778 | RubberDandelionOmics

Gene overview

LXL04_025778

Reference: OH-1004 Chr: Chr05 Coordinates: 116835659-116836835 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · LXL04_025778|LXL04_025778|OH1004|cDNA

ATGGCTTCAAGGACTGCGAGCAAAGACATAATCACTCTCCGTGGATCCACAGCCATCGTCAGCGAATTTTTCGGTTATGCAGCAAACAGTATTCTGTACAATCGTGGTGTTTACCCTGAAGAAACTTTCGAAAGAGTGAAGAAATATGGACTTCCATTGTTGCTTTCTCAGGACGAGGGCGTTAAGACATTCATCTCAAATCTACATAAGCAGCTTTCCGAATGGCTGGAAGCTGGGAAGTTACAAAGGATTGTACTTGT...

CDS

Download CDS FASTA

624 bp · LXL04_025778|LXL04_025778|OH1004|CDS

ATGGCTTCAAGGACTGCGAGCAAAGACATAATCACTCTCCGTGGATCCACAGCCATCGTCAGCGAATTTTTCGGTTATGCAGCAAACAGTATTCTGTACAATCGTGGTGTTTACCCTGAAGAAACTTTCGAAAGAGTGAAGAAATATGGACTTCCATTGTTGCTTTCTCAGGACGAGGGCGTTAAGACATTCATCTCAAATCTACATAAGCAGCTTTCCGAATGGCTGGAAGCTGGGAAGTTACAAAGGATTGTACTTGT...

Protein

Download Protein FASTA

207 aa · LXL04_025778|LXL04_025778|OH1004|PROTEIN

MASRTASKDIITLRGSTAIVSEFFGYAANSILYNRGVYPEETFERVKKYGLPLLLSQDEGVKTFISNLHKQLSEWLEAGKLQRIVLVIMSKATNEVLERWNFSIETDGEVVEKGISREKSDKEIMREIQAIMRQIASSITYLPCLDEPCIFDVLAYTDTDVAVPFTWTESDPKLIANPQMVKLHSFDTKIHKVDTLVSYKNDEWDDQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025778`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025778

Location Chr05:116835659-116836835 (+)

Description Similar to MAD2: Mitotic spindle checkpoint protein MAD2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25980`	Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and delays the onset of anaphase when this process is not complete.	Spindle assembly checkpoint protein dynamics reveal conserved and unsuspected roles in plant cell division.2009 · DOI: 10.1371/journal.pone.0006757

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025778 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000070 mitotic sister chromatid segregation Biological Process

GO:0000132 establishment of mitotic spindle orientation Biological Process

GO:0007094 mitotic spindle assembly checkpoint signaling Biological Process

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0045841 negative regulation of mitotic metaphase/anaphase transition Biological Process

GO:0045930 negative regulation of mitotic cell cycle Biological Process

GO:0051301 cell division Biological Process

GO:0051660 establishment of centrosome localization Biological Process

GO:0090267 positive regulation of mitotic cell cycle spindle assembly checkpoint Biological Process

GO:1904667 negative regulation of ubiquitin protein ligase activity Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

KEGG gene cross-reference

ath:AT3G25980

ddi:DDB_G0273201

ddi:DDB_G0273727

hsa:4085

mmu:56150

zma:542621

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.521

Rank 1 · LXL04_025778 · OH-1004

Cytoplasm0.482

Rank 2 · LXL04_025778 · OH-1004

Lysosome / Vacuole0.092

Rank 3 · LXL04_025778 · OH-1004

Golgi apparatus0.072

Rank 4 · LXL04_025778 · OH-1004

Cell membrane0.058

Rank 5 · LXL04_025778 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02301.24HORMA16-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025778	`PF02301.24`	HORMA	16	191	4.8e-23	82.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LU93`	Arabidopsis thaliana	Mitotic spindle checkpoint protein MAD2	84.135%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card