LXL04_025749 | RubberDandelionOmics

Gene overview

LXL04_025749

Reference: OH-1004 Chr: Chr05 Coordinates: 116531824-116538808 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1086 bp · LXL04_025749|LXL04_025749|OH1004|cDNA

ATGAAGCATTCCAACGTTATTGCGAATTTGGGCTTCCCGATCGAATACACCAACAAAAGCATCAAGAGTTGTTGCTTCCTTTTTCCTCTCAAGATCACCGCATACAAAAAACTTATTCGATTTACTAAGTTCGTAAAGCCGGCAGTTGAAGACAGTGGAGACGAAGTGACGACTTTTGAAACGAAGGAGGATGAGCCAACTCAGACAACTCAAGCCATCGATTCCTTCATTTCCTCCCTTCCTCACCTCCGATTAGTTGG...

CDS

Download CDS FASTA

1086 bp · LXL04_025749|LXL04_025749|OH1004|CDS

ATGAAGCATTCCAACGTTATTGCGAATTTGGGCTTCCCGATCGAATACACCAACAAAAGCATCAAGAGTTGTTGCTTCCTTTTTCCTCTCAAGATCACCGCATACAAAAAACTTATTCGATTTACTAAGTTCGTAAAGCCGGCAGTTGAAGACAGTGGAGACGAAGTGACGACTTTTGAAACGAAGGAGGATGAGCCAACTCAGACAACTCAAGCCATCGATTCCTTCATTTCCTCCCTTCCTCACCTCCGATTAGTTGG...

Protein

Download Protein FASTA

361 aa · LXL04_025749|LXL04_025749|OH1004|PROTEIN

MKHSNVIANLGFPIEYTNKSIKSCCFLFPLKITAYKKLIRFTKFVKPAVEDSGDEVTTFETKEDEPTQTTQAIDSFISSLPHLRLVGSHLRRLSYAPPTPVIQPTTAASADAPAVPISSSPAQLVIPAPLSGLSFTNDDIPSRTGLLKLASCFLLAKGLDRSGKTSQSGRLLSYLNSVGYPVESWRFPDRDTAVGKMISSYLTNQSQSLMEAKLKSGTSLIIDRYSYSGVAFSSAKGLDIQWCKAPEVGLLAPDLVMYLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025749`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025749

Location Chr05:116531824-116538808 (+)

Description Similar to ZEU1: Thymidylate kinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59440`	Catalyzes the conversion of dTMP to dTDP (Probable).	The first zygotic division in Arabidopsis requires de novo transcription of thymidylate kinase.2008 · DOI: 10.1111/j.1365-313x.2007.03372.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025749 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006227 dUDP biosynthetic process Biological Process

GO:0006233 dTDP biosynthetic process Biological Process

GO:0006235 dTTP biosynthetic process Biological Process

GO:0006281 DNA repair Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G59440

ddi:DDB_G0290033

dme:Dmel_CG5757

dre:567734

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.845

Rank 1 · LXL04_025749 · OH-1004

Mitochondrion0.124

Rank 2 · LXL04_025749 · OH-1004

Cytoplasm0.092

Rank 3 · LXL04_025749 · OH-1004

Nucleus0.075

Rank 4 · LXL04_025749 · OH-1004

Peroxisome0.030

Rank 5 · LXL04_025749 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02223.24Thymidylate_kin158-205 aa

PF02223.24Thymidylate_kin207-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025749	`PF02223.24`	Thymidylate_kin	158	205	2.4e-28	99.8
LXL04_025749	`PF02223.24`	Thymidylate_kin	207	304	2.4e-28	99.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WW55`	Arabidopsis thaliana	Thymidylate kinase	63.030%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card