LXL04_025728 | RubberDandelionOmics

Gene overview

LXL04_025728

Reference: OH-1004 Chr: Chr05 Coordinates: 115942780-115943624 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

678 bp · LXL04_025728|LXL04_025728|OH1004|cDNA

ATGGAACATCTAAATTCCGTCAACAATGGTAGCCTCCGATTACCTCCTGGGTTCAGGTTCTTCCCAACTGATGAAGAGCTTATCGTACACTTTTTGAAACGCAAGGTCCAATCCCGCCCTGTTGCTTCCGACATCATCACTGAAGCTGATGTTTGCAGGTCTGATCCATGGGATTTACCAGGTGATCCGAAGCAAGAAAGGTACTTCTATAGCAACATGGAAATCAAGTACCCAAATGGAAAACGATCCAATCGGGCCAC...

CDS

Download CDS FASTA

678 bp · LXL04_025728|LXL04_025728|OH1004|CDS

ATGGAACATCTAAATTCCGTCAACAATGGTAGCCTCCGATTACCTCCTGGGTTCAGGTTCTTCCCAACTGATGAAGAGCTTATCGTACACTTTTTGAAACGCAAGGTCCAATCCCGCCCTGTTGCTTCCGACATCATCACTGAAGCTGATGTTTGCAGGTCTGATCCATGGGATTTACCAGGTGATCCGAAGCAAGAAAGGTACTTCTATAGCAACATGGAAATCAAGTACCCAAATGGAAAACGATCCAATCGGGCCAC...

Protein

Download Protein FASTA

225 aa · LXL04_025728|LXL04_025728|OH1004|PROTEIN

MEHLNSVNNGSLRLPPGFRFFPTDEELIVHFLKRKVQSRPVASDIITEADVCRSDPWDLPGDPKQERYFYSNMEIKYPNGKRSNRATTSGYWKATGLDKQIVDSKNKQVAGTKKTLVFYRGKAPIGSKTNWIMHEYKLVNPIEGSENWVICRMFLKKRGKGGENDVEGVRIAEAGPIFYDFMADIPRTGDLNLGPVASSSGSSGVTNASPMADEGEEISKYMRKT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025728`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025728

Location Chr05:115942780-115943624 (-)

Description Similar to NAC083: NAC domain-containing protein 83

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13180`	Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation.	VND-INTERACTING2, a NAC domain transcription factor, negatively regulates xylem vessel formation in Arabidopsis.2010 · DOI: 10.1105/tpc.108.064048 The Arabidopsis NAC transcription factor VNI2 integrates abscisic acid signals into leaf senescence via the COR/RD genes.2011 · DOI: 10.1105/tpc.111.084913 Arabidopsis thaliana NAC083 protein interacts with Mungbean yellow mosaic India virus (MYMIV) Rep protein.2014 · DOI: 10.1007/s11262-013-1028-6
`At2g33480`	Transcription activator of the mannan synthase CSLA9.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0566500`	Transcription factor of the NAC family associated with male fertility.	No verified direct reference in this release
`UniProt: A2YMR0`	Transcription factor of the NAC family associated with male fertility.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025728 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0010089 xylem development Biological Process

GO:0010150 leaf senescence Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0048653 anther development Biological Process

KEGG gene cross-reference

ath:AT2G33480

ath:AT5G13180

dosa:Os07g0566500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.941

Rank 1 · LXL04_025728 · OH-1004

Cytoplasm0.103

Rank 2 · LXL04_025728 · OH-1004

Cell membrane0.045

Rank 3 · LXL04_025728 · OH-1004

Endoplasmic reticulum0.040

Rank 4 · LXL04_025728 · OH-1004

Plastid0.017

Rank 5 · LXL04_025728 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02365.21NAM15-138 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025728	`PF02365.21`	NAM	15	138	1e-43	149.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FY93`	Arabidopsis thaliana	NAC domain-containing protein 83	52.915%	Swiss-Prot	strong database homology
`O22798`	Arabidopsis thaliana	NAC domain-containing protein 41	50.877%	Swiss-Prot	strong database homology
`Q8H4S4`	Oryza sativa subsp. japonica	NAC domain-containing protein 10	50.562%	Swiss-Prot	moderate database homology
`A2YMR0`	Oryza sativa subsp. indica	NAC transcription factor ONAC010	50.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card